SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gnl|MincDB|prot:Minc16211 from Meloidogyne incognita

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gnl|MincDB|prot:Minc16211
Domain Number 1 Region: 3-286
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex, superhelical domain 6.15e-46
Family Lipovitellin-phosvitin complex, superhelical domain 0.00012
Further Details:      
 
Domain Number 2 Region: 492-668
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 2.9e-18
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gnl|MincDB|prot:Minc16211
Sequence length 1446
Comment length:1446 contig:MiV1ctg1120 region:2468-8022 strand:-
Sequence
MCSYEDLKQIEQNSQQYHQNQQQTAKQILVDAMAISGTRNCVVRMAEIINNQEVSPHKAA
YTISQLTGLQSPSNLIVKEVQKLCQSEQVKNRSIVKQSACLTFGALVNELCSQRRSEKTP
DLSHSIPEQCTEDKKEQYKQVLVEQYEKATTLQEKLNALASLGNAGIDTSAPQLEQIIKD
RSEPSLSRAKAIDALRRLTTKEPMTLQHMLLPIYLNNQEDPNVRIVALQILIRTQPEPSV
IDQIIYTMSQEPNKRVKAYTYQTMKMVAKSKNPADRQMSKHVKNAMQSANVDEQQLWSYA
KWQIPVYSPEQEEGIFLTLATEYSQRSWMPSLSYMKIDSYFKDQSNVNDLVFYLMKNQPL
YGQDYTKSRNRRTVPIRIDRRKFEQENNENTQQLKDMHSQLGIKSRHGGYSFNDRYSRSG
QQQQQKYNHNNNINVFCTRIGDVDHSCFEIQNSYLNQTTQQQQQESSMPTLPPMFAELIQ
SIQNRRKPSLAKMFSELKQLQQQKVHQYTIASILNDKEAVVPTCVGLPLGIANFVPTILN
VQGNVNLQKNTEMGGKVQINGRIMGGMAHIQKMRCWTPFLVSGIKSIRSIEINIPTQLDI
NIQTTNNGKQSLTLSVKLPKEKTRLVGAHSHPFVYTADVDPKTESVIEPRKVKTITNPKL
DRLQYQMNTVFGGKNLGIPVNVHAHYHWPSSSANVEQICKMLMATENAIHVTYQPRGEES
AKEVVFQMNLESFQPTNNYQLKMNDFYLNKFTNIENEEGEEGNNYEEENEQNSKRRQQKM
SKFLTNYSKQQQKYYKHNLEMSAKTVGGPKEFKFQTKLEAKCEETMQTCQLEIQAERSPI
NNEQQEWTLKAQAEMVMPENVENNEEFNEEEEENKIKNNLFSCKANCYWGNNDGNKQTIN
VRINGEQSTTRRKEWNSNNQQRMNKEFEIKLKRRTAFINKFNCEAKYTNLKSTTRNVFER
ALELVKSKYFWNTKSQLIDQNREGNPANGEAYLNIVIDPITQKHANMTVKTPLQLIRFQQ
IELPIQMRPFPLLRQQNVYQNIQSFGQFLTRQEVESRAECSVDGQTVETFDEREYRSPLS
TNCYSVLAKDCGADYMGVPRFVVLMKAIERGNKYSQKKLKIISPQMVVECQRESLNNHNS
PIKCKINGKEENNYQQQQLIQYNNNQKSDLIINWDKLAIRFNGFKVWIKISSEYRNTQCG
LCGHYDDASNDENELLMANNEIAPSLTQFHRSYSLSNSYDNDDKLCNAQELDKFYEENSN
KFGYLNEMEEEEREEGKENKVYQNWDEEGFDGNFDKNEENKRFYNEEWYGQNEREDNNYQ
QKNQLATIKSGNRNLKRRFVPILIRTKIMEMENDICFSKQPIKQCPLGSYPSGWEFEEEN
NKNKHFTTKNIPFICLPRSDSETRNLLNQYRQLMKNGNNQQQLELNNYKQHSIVEQVLEP
KECRRL
Download sequence
Identical sequences gnl|MincDB|prot:Minc16211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]