SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gnl|MincDB|prot:Minc16212 from Meloidogyne incognita

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gnl|MincDB|prot:Minc16212
Domain Number 1 Region: 55-196,227-309
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 3.77e-26
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gnl|MincDB|prot:Minc16212
Sequence length 518
Comment length:518 contig:MiV1ctg1120 region:8096-10213 strand:-
Sequence
MRINSILLLLAIGLLGPSTLVVGDEYPATSTLKRFFYRHFFADNSAFEQTRAPNFEEGTV
YHYSYDAQVESGLSTLDESGTTTQTSDNGQQAVTRIQSQVKVYFASQTRAQLCMTQNRFG
QLNEQTKQTDSSNQCYEPLSTFEPKQIPQEQRQKLELCCQFDYVDGVIVRVQFDKQDEAW
SKNMKKGVLNMIQMNLRQNNAQELASEQSRNQQDGNIDENEATQMRDQLAHSFTIPEVTV
EGECQTTYTINTANPSKNCTQKGYDGSNKQQQMPCSFNLTKSINFKQCSRIGDISAGFQT
EQPQARCAQCKMDWYKQKERDQQQTGTAEHPCAKCDPKRVKEETLDRQTVMRAMLKCGSE
QQMIEGKQQETQNSCQLDSSEMRSMYVYKNTKTESGPYGSAMRTEVCAKLQLRSAQSSQD
QQVPTQTLDNDESLVYTVQTYTDFARFYMFGDEEFPDPTNSPFSSVPKVEQAGQALRALV
QNENPESGSGSGKFRAPDLGFYRFLDLPNFLVFFYKKG
Download sequence
Identical sequences gnl|MincDB|prot:Minc16212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]