SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385792534|ref|YP_005825510.1| from Francisella cf. novicida Fx1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385792534|ref|YP_005825510.1|
Domain Number 1 Region: 3-143
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6.07e-49
Family Ribonuclease PH domain 1-like 0.0000281
Further Details:      
 
Domain Number 2 Region: 300-495
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.63e-44
Family Ribonuclease PH domain 1-like 0.0000175
Further Details:      
 
Domain Number 3 Region: 453-551
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.75e-29
Family Ribonuclease PH domain 2-like 0.0000996
Further Details:      
 
Domain Number 4 Region: 145-234
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.09e-26
Family Ribonuclease PH domain 2-like 0.0014
Further Details:      
 
Domain Number 5 Region: 558-643
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.52e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.0042
Further Details:      
 
Domain Number 6 Region: 238-321
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 2.59e-17
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0017
Further Details:      
 
Domain Number 7 Region: 622-691
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000021
Family Cold shock DNA-binding domain-like 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|385792534|ref|YP_005825510.1|
Sequence length 693
Comment hypothetical protein [Francisella cf. novicida Fx1]
Sequence
MKIFREVFELGNKEIILETGGMARQADGSVTVSCGNNVVLVTTVVKKSVADGTDFFPLSV
HYLEKTYAAGKIPGGFLRREGRPSEEQILISRLIDRSIRPSFPDGFFNEIQIVATVLSYD
GAFSPDILALIGASASLAISGAPYDDVVAGVRVGYTNGKYILNPNKQDLRDSDLDLVVSG
TDDAILMVESEANSLPESVMLGGILYAHKHLKTIINSINRLAKVASKARIEYSIYQINKF
LKSQIKSQFFGEIKNAYTIASKQERNLKLNAIRKNVLEYIFSSDVDGNEYTEKEILEAFH
DIEKDLVRSNILEGKPRIDGRCTETIRPINVKIGVLPGVHGSALFTRGETQALVVTTLGS
DRDAQLVESLDGIEKCRYMLHYNFPPYSVGECGMVGMAPKRREIGHANLAKRATQAVFPN
EEAYPYVVRVVSEILESNGSSSMATVCGSSLSMMDAGVPIAEPVAGIAMGLIKDGTKYAV
LSDILGDEDHLGDMDFKVAGTRYGVTALQMDIKIKGISREILEQALEQARVGRLHILGIM
NEVIKEHKEAVSDVAPQIHVMNINPAKIKDVVGRGGATVKGIVEKTGAQIDTSDSGEVKV
FAKDKKSMDMAVAMIEEIVAEVEEGQVYKGKIVKLLDSGVFVNLLGSQDGYLPFSEIEQA
GMKTNSLVEGQGLEVLVQNIDRGGRVKLSLVAR
Download sequence
Identical sequences WP_014549529.1.66025 gi|385792534|ref|YP_005825510.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]