SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385792832|ref|YP_005825808.1| from Francisella cf. novicida Fx1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385792832|ref|YP_005825808.1|
Domain Number 1 Region: 198-394
Classification Level Classification E-value
Superfamily PheT/TilS domain 5.49e-73
Family B3/B4 domain of PheRS, PheT 0.0000255
Further Details:      
 
Domain Number 2 Region: 41-195
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.41e-50
Family Myf domain 0.0022
Further Details:      
 
Domain Number 3 Region: 470-687
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 8.45e-46
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00015
Further Details:      
 
Domain Number 4 Region: 693-789
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 1.57e-25
Family Anticodon-binding domain of PheRS 0.0015
Further Details:      
 
Domain Number 5 Region: 405-478
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 1.1e-17
Family Domains B1 and B5 of PheRS-beta, PheT 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|385792832|ref|YP_005825808.1|
Sequence length 790
Comment hypothetical protein [Francisella cf. novicida Fx1]
Sequence
MKFSHNWLNEYLNDTQTSQDLAGTLTLAGLEVDAIESVVAEKVSGVVVGQIKTINKHPDA
DKLNVCSVDAGEDELLTIVCGASNIYEGMKAPVAKIGAVLPGNFKIKKSKLRGQESFGMM
CSEEELGLADKADGLMDLPVNAPVGTDINKYLNLDDNIIEVDLTPNRADCLSVYGIAREV
SALTKTELKDLEILEPKVVIDDTKEVNITATDACHAYYGCIIKNVNNKIQTPLWMVEKLR
RSGIGSISFFVDVTNYVMLLTGQPMHAFDLDKLAGGINVRYAKNNEELTLLDQTQVKLDS
DTLVIADDKKALAIAGVMGGLDSSITDSTTNIFLESAFFVPEKIAGKARKYNLHTDSSHR
FERGVDPQLAKKAMKIAIRLINEIAGGEVAPIHGAEDLANLNKQVKINLSINKLNHVLGT
NFDIEYVTEVLKALHMDVATSFDGNCIEVIPPSYRFDMEIPEDLIEEVARIYGYSKLPET
MPKYAAAKTNISETYQSLDTLNMRLIDRGYHETINYSFIDPKFDEFFFADRGIAIQNPIS
QDLSIMRQSLIPGLINTFKANTSRQQNRVRIFEKGACFKLQDNQRIQFDRIAGLAYGELL
NINWSNSKKVDFFDVKADVEALCNDLTRLSFEVCNDINWLHPGQSAYILANGNKIGVIGV
IHPTVLKNFQIKAKAPIVFELDLDVLTKRQIPNFTKISKYPSVSRDISFLVDKSVLAGDI
IKAIRALNINILKDVSIFDIYESQDSDRKSIALNMLFQDNLQTLDDKVIVESMDKVLEAL
KTKFNIEQRV
Download sequence
Identical sequences gi|385792832|ref|YP_005825808.1| WP_014549753.1.66025

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]