SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385793224|ref|YP_005826200.1| from Francisella cf. novicida Fx1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385793224|ref|YP_005826200.1|
Domain Number 1 Region: 16-227
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 3.53e-57
Family PP-loop ATPase 0.0000518
Further Details:      
 
Domain Number 2 Region: 306-397
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.000000000000068
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.0097
Further Details:      
 
Domain Number 3 Region: 205-306
Classification Level Classification E-value
Superfamily MesJ substrate recognition domain-like 0.000000183
Family MesJ substrate recognition domain-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|385793224|ref|YP_005826200.1|
Sequence length 398
Comment hypothetical protein [Francisella cf. novicida Fx1]
Sequence
MSISKSLVLNEIKKFSPSHIIIGYSGGVDSSVLLNISKELDIPLIAIYINHNLHRDSLKW
QIHCQQICQKYNLQFISHSLDKVPKGESFEAWASKQRMAFFQKIMQQYSKPLLLLGHHQD
DQAETFLIQAIRGSGLAGLAGIPYYKELQHGGVLRPLLKYSKIEIEEFAKLNNISYIYDD
SNEDIKYRRNLIRNQIIPILQQVNPNISQTLSRSANICAESNNILQKLLTERLQSISQDT
NLIISELIKLDDDIQKSLLHLWFKQNTQQSLKSKQIKELHLAVNNSSTGWQIDISNYYQI
HIQYNQLIIKYPTTINHMSKEDIISWLSKNLNEEIDLTKIVIRDRKPDDKCKYRGRNKPN
KLKILFQELQIPTTERSKAKIILKDQQIIAVYPFFICG
Download sequence
Identical sequences gi|385793224|ref|YP_005826200.1| WP_003037047.1.59804 WP_003037047.1.66025 WP_003037047.1.91892

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]