SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385792590|ref|YP_005825566.1| from Francisella cf. novicida Fx1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385792590|ref|YP_005825566.1|
Domain Number 1 Region: 1-132
Classification Level Classification E-value
Superfamily Cytidine deaminase-like 1.42e-38
Family Cytidine deaminase 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|385792590|ref|YP_005825566.1|
Sequence length 133
Comment hypothetical protein [Francisella cf. novicida Fx1]
Sequence
MTQKQDQQLIEYAKEAFNNAYAPFSGFKVGAALLMKDGNIINSANIETSILGLSVCAERN
AIFYAYSQGYRKDDIVKIAVVADTEKAISPCGACRQIMSEHLNLDCPIILTNMSNTDRLD
TNTKELLPYIFSL
Download sequence
Identical sequences A0A0B6KKQ9
WP_003033452.1.43725 WP_003033452.1.64199 WP_003033452.1.66025 WP_003033452.1.70888 WP_003033452.1.89268 WP_003033452.1.89309 gi|385792590|ref|YP_005825566.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]