SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|387885874|ref|YP_006316173.1| from Francisella noatunensis subsp. orientalis str. Toba 04

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|387885874|ref|YP_006316173.1|
Domain Number 1 Region: 4-152
Classification Level Classification E-value
Superfamily Cytidine deaminase-like 1.59e-46
Family Deoxycytidylate deaminase-like 0.0000486
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|387885874|ref|YP_006316173.1|
Sequence length 153
Comment zinc-binding protein [Francisella noatunensis subsp. orientalis str. Toba 04]
Sequence
MSNYSQDDIFFMQKAYEQALLAYRAGEVPIGAVLVNDSQIVVQDFNKTIMLNDPTAHAEI
LVLRETAKELENYRLVNTKLYVTLEPCIMCLGGLIQARVSELIYACDDTRVGIFSREKLH
QNKNINHNLKVTSGVMTEECSKLLRDFFKLKRN
Download sequence
Identical sequences I2AX00
WP_014714251.1.21969 WP_014714251.1.36379 WP_014714251.1.38482 WP_014714251.1.41272 WP_014714251.1.49925 WP_014714251.1.70881 WP_014714251.1.71620 WP_014714251.1.95278 gi|387885874|ref|YP_006316173.1| gi|565641857|ref|YP_008892485.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]