SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|387886265|ref|YP_006316564.1| from Francisella noatunensis subsp. orientalis str. Toba 04

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|387886265|ref|YP_006316564.1|
Domain Number 1 Region: 103-231
Classification Level Classification E-value
Superfamily alpha-helical ferredoxin 4.36e-39
Family Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain 0.00000188
Further Details:      
 
Domain Number 2 Region: 2-102
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 1.11e-28
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.0000624
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|387886265|ref|YP_006316564.1|
Sequence length 233
Comment succinate dehydrogenase iron-sulfur subunit [Francisella noatunensis subsp. orientalis str. Toba 04]
Sequence
MDVRFKIYRYNPEVDKKPYYDEYTVTVENEGVKVLTALELIKEQDPTLAMRRSCREGVCG
SDGMNINGKNRLACITSVGELKQPVKVNPLPGLPVVRDLIVDMKQFYKNYEKVKPYLIND
EEPPVKERLQSPEDRAELDGLYECILCACCTTSCPSFWWNPDKFIGPSGLLQAYRFIADS
RDTATEQRLEDLKDPFSLFRCRTIMNCVSVCPKGLNPTEAIGKIRSALLKKNV
Download sequence
Identical sequences I2AY41
gi|387886265|ref|YP_006316564.1| WP_014714631.1.21969 WP_014714631.1.36379 WP_014714631.1.38482 WP_014714631.1.41272 WP_014714631.1.49925 WP_014714631.1.70881 WP_014714631.1.71620 WP_014714631.1.95278 gi|565642970|ref|YP_008893860.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]