SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|387886837|ref|YP_006317136.1| from Francisella noatunensis subsp. orientalis str. Toba 04

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|387886837|ref|YP_006317136.1|
Domain Number 1 Region: 7-129
Classification Level Classification E-value
Superfamily Cytidine deaminase-like 4.18e-40
Family Cytidine deaminase 0.0000408
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|387886837|ref|YP_006317136.1|
Sequence length 133
Comment cytidine deaminase [Francisella noatunensis subsp. orientalis str. Toba 04]
Sequence
MSNDINNKLIDAAIQAAENAYTPYSKFNVGATLLMKDGSILKGANVENASYGLCNCAERT
VLFYAYAQGYRKEDIKKLAVVADTPEGVSPCGACRQVMSELLDLECPIILSNIRKTDIKE
TNIKELLPYMFSF
Download sequence
Identical sequences I2AZR3
WP_014715190.1.21969 WP_014715190.1.36379 WP_014715190.1.38482 WP_014715190.1.41272 WP_014715190.1.49925 WP_014715190.1.70881 WP_014715190.1.71620 WP_014715190.1.95278 gi|565642236|ref|YP_008892939.1| gi|387886837|ref|YP_006317136.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]