SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385793899|ref|YP_005830305.1| from Francisella tularensis subsp. tularensis NE061598

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385793899|ref|YP_005830305.1|
Domain Number 1 Region: 3-110
Classification Level Classification E-value
Superfamily N-utilization substance G protein NusG, N-terminal domain 5.23e-34
Family N-utilization substance G protein NusG, N-terminal domain 0.00013
Further Details:      
 
Domain Number 2 Region: 122-175
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 2.81e-19
Family N-utilization substance G protein NusG, C-terminal domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|385793899|ref|YP_005830305.1|
Sequence length 177
Comment transcription termination factor NusG [Francisella tularensis subsp. tularensis NE061598]
Sequence
MLWYVVQVHSGYEKRVKAQLEENIEIAGLKNNFGRILVPTENVVEMKGGQKRKSERKYFP
GYVLIEADLSTDAWNLVKSVPRVLTVVGSKGKPIPLSKAEVDRILDFVEGSKSTVEPRLR
KSYHVGEVVRVLEGPFNDFTGVIEEVNYEKSRLRVAVSIFGRSTPVELEFSQVEKES
Download sequence
Identical sequences A0A0E2ZTG8 A0A0G2RNE5 Q5NID7
gi|134301348|ref|YP_001121316.1| gi|56707309|ref|YP_169205.1| gi|385793899|ref|YP_005830305.1| gi|187931078|ref|YP_001891062.1| 177416.FTT_0139 393115.FTF0139 418136.FTW_0229 441952.FTM_0204 gi|379725192|ref|YP_005317378.1| gi|379716509|ref|YP_005304845.1| WP_003024800.1.101979 WP_003024800.1.10388 WP_003024800.1.11695 WP_003024800.1.17073 WP_003024800.1.17471 WP_003024800.1.1833 WP_003024800.1.19035 WP_003024800.1.2301 WP_003024800.1.25812 WP_003024800.1.26192 WP_003024800.1.31410 WP_003024800.1.35965 WP_003024800.1.3831 WP_003024800.1.38368 WP_003024800.1.38474 WP_003024800.1.38662 WP_003024800.1.39861 WP_003024800.1.42944 WP_003024800.1.44744 WP_003024800.1.52816 WP_003024800.1.53326 WP_003024800.1.5563 WP_003024800.1.56738 WP_003024800.1.5829 WP_003024800.1.59625 WP_003024800.1.60146 WP_003024800.1.61154 WP_003024800.1.65967 WP_003024800.1.66077 WP_003024800.1.66092 WP_003024800.1.66463 WP_003024800.1.67317 WP_003024800.1.75261 WP_003024800.1.77053 WP_003024800.1.78037 WP_003024800.1.80616 WP_003024800.1.82545 WP_003024800.1.87851 WP_003024800.1.95561 WP_003024800.1.98147 YP_169205.1.84429 gi|110669779|ref|YP_666336.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]