SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385793914|ref|YP_005830320.1| from Francisella tularensis subsp. tularensis NE061598

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385793914|ref|YP_005830320.1|
Domain Number 1 Region: 2-114
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 1.6e-42
Family Ribosomal protein L19 0.000024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|385793914|ref|YP_005830320.1|
Sequence length 115
Comment 50S ribosomal protein L19 [Francisella tularensis subsp. tularensis NE061598]
Sequence
MKNKFVELVEKSQLRTDLPEFNPGDSITVNLWIKEGDKQRIQAFKGFVLRKRNRGLHSAF
TVRKMSSGMGVERTFQTHSPLIDSIIVEKRADVRRAKLYYMRGLTGRAARIKEKV
Download sequence
Identical sequences A0A0E2ZML3 A0A0M1U4K4 Q14JS6 Q5NIC3
177416.FTT_0153 393115.FTF0153 gi|379716523|ref|YP_005304859.1| IDP04570 gi|110669793|ref|YP_666350.1| gi|56707323|ref|YP_169219.1| WP_003019923.1.101979 WP_003019923.1.10388 WP_003019923.1.11695 WP_003019923.1.1833 WP_003019923.1.19035 WP_003019923.1.2301 WP_003019923.1.25812 WP_003019923.1.31410 WP_003019923.1.35965 WP_003019923.1.36081 WP_003019923.1.3831 WP_003019923.1.38368 WP_003019923.1.38474 WP_003019923.1.38662 WP_003019923.1.40634 WP_003019923.1.44744 WP_003019923.1.52816 WP_003019923.1.56738 WP_003019923.1.5829 WP_003019923.1.59625 WP_003019923.1.60146 WP_003019923.1.61154 WP_003019923.1.65967 WP_003019923.1.66077 WP_003019923.1.66092 WP_003019923.1.67317 WP_003019923.1.75261 WP_003019923.1.77053 WP_003019923.1.80616 WP_003019923.1.82545 WP_003019923.1.87851 WP_003019923.1.98147 YP_169219.1.84429 gi|385793914|ref|YP_005830320.1| gi|379725206|ref|YP_005317392.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]