SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385793990|ref|YP_005830396.1| from Francisella tularensis subsp. tularensis NE061598

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385793990|ref|YP_005830396.1|
Domain Number 1 Region: 2-63
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 1.08e-19
Family eIF5a N-terminal domain-like 0.0052
Further Details:      
 
Domain Number 2 Region: 130-187
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 7.02e-18
Family Cold shock DNA-binding domain-like 0.00053
Further Details:      
 
Domain Number 3 Region: 67-125
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 5.14e-16
Family Cold shock DNA-binding domain-like 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|385793990|ref|YP_005830396.1|
Sequence length 189
Comment translation elongation factor P [Francisella tularensis subsp. tularensis NE061598]
Sequence
MASYSTNEFKGGLKVLIDGNPMVIVENEFVKPGKGQAFNRVKLKNLLNDRVVEKTFKSGE
SVEAADVEELTTVYSYFDGDSYVFMHPETFEQYMVSEEALGETKKWLKDQDEYQVILFNG
QPISIIAANFVNLEIIETDPGLKGDTAGTGGKPATLSTGAVVRVPLFVQTGEIIKVDTRT
STYVSRVKD
Download sequence
Identical sequences A0A0B3WI89 A0A0E3A7U7 A0A0H3TQE5 A4J019 A7N9M0 B2SE64 Q0BNX7 Q14JL2 Q2A5M4 Q5NI60
gi|115314121|ref|YP_762844.1| gi|134302672|ref|YP_001122641.1| gi|156501564|ref|YP_001427629.1| gi|89255616|ref|YP_512977.1| gi|379725265|ref|YP_005317451.1| WP_003014194.1.100020 WP_003014194.1.100480 WP_003014194.1.100639 WP_003014194.1.101979 WP_003014194.1.10388 WP_003014194.1.11004 WP_003014194.1.11695 WP_003014194.1.12700 WP_003014194.1.12820 WP_003014194.1.13116 WP_003014194.1.1316 WP_003014194.1.13715 WP_003014194.1.13896 WP_003014194.1.1431 WP_003014194.1.15828 WP_003014194.1.17073 WP_003014194.1.17117 WP_003014194.1.17471 WP_003014194.1.18135 WP_003014194.1.1833 WP_003014194.1.19035 WP_003014194.1.19348 WP_003014194.1.21553 WP_003014194.1.2186 WP_003014194.1.2301 WP_003014194.1.24109 WP_003014194.1.24307 WP_003014194.1.2436 WP_003014194.1.25474 WP_003014194.1.25812 WP_003014194.1.26192 WP_003014194.1.26690 WP_003014194.1.27183 WP_003014194.1.27408 WP_003014194.1.28031 WP_003014194.1.28288 WP_003014194.1.30377 WP_003014194.1.31247 WP_003014194.1.3134 WP_003014194.1.31410 WP_003014194.1.31907 WP_003014194.1.33374 WP_003014194.1.34036 WP_003014194.1.35898 WP_003014194.1.35965 WP_003014194.1.36081 WP_003014194.1.36125 WP_003014194.1.36481 WP_003014194.1.37362 WP_003014194.1.37819 WP_003014194.1.38195 WP_003014194.1.3831 WP_003014194.1.38368 WP_003014194.1.38474 WP_003014194.1.38662 WP_003014194.1.38763 WP_003014194.1.3975 WP_003014194.1.39861 WP_003014194.1.40634 WP_003014194.1.40692 WP_003014194.1.41167 WP_003014194.1.42944 WP_003014194.1.43575 WP_003014194.1.43882 WP_003014194.1.44313 WP_003014194.1.44744 WP_003014194.1.44922 WP_003014194.1.45210 WP_003014194.1.45908 WP_003014194.1.4633 WP_003014194.1.46791 WP_003014194.1.46956 WP_003014194.1.47286 WP_003014194.1.47340 WP_003014194.1.48020 WP_003014194.1.48098 WP_003014194.1.48962 WP_003014194.1.50994 WP_003014194.1.51529 WP_003014194.1.52816 WP_003014194.1.53326 WP_003014194.1.5414 WP_003014194.1.54420 WP_003014194.1.5487 WP_003014194.1.54961 WP_003014194.1.55289 WP_003014194.1.5563 WP_003014194.1.56738 WP_003014194.1.57478 WP_003014194.1.5829 WP_003014194.1.59625 WP_003014194.1.59871 WP_003014194.1.5992 WP_003014194.1.60112 WP_003014194.1.60146 WP_003014194.1.60504 WP_003014194.1.61154 WP_003014194.1.63091 WP_003014194.1.63562 WP_003014194.1.64987 WP_003014194.1.65566 WP_003014194.1.65967 WP_003014194.1.66077 WP_003014194.1.66092 WP_003014194.1.66463 WP_003014194.1.67317 WP_003014194.1.6752 WP_003014194.1.68327 WP_003014194.1.69118 WP_003014194.1.69545 WP_003014194.1.69933 WP_003014194.1.7106 WP_003014194.1.72408 WP_003014194.1.72665 WP_003014194.1.73228 WP_003014194.1.73973 WP_003014194.1.74506 WP_003014194.1.74697 WP_003014194.1.75261 WP_003014194.1.77053 WP_003014194.1.77714 WP_003014194.1.77892 WP_003014194.1.78037 WP_003014194.1.78521 WP_003014194.1.80474 WP_003014194.1.80603 WP_003014194.1.80616 WP_003014194.1.82216 WP_003014194.1.8254 WP_003014194.1.82545 WP_003014194.1.83968 WP_003014194.1.84288 WP_003014194.1.84370 WP_003014194.1.85044 WP_003014194.1.85695 WP_003014194.1.85899 WP_003014194.1.87224 WP_003014194.1.87451 WP_003014194.1.87851 WP_003014194.1.88243 WP_003014194.1.90324 WP_003014194.1.93025 WP_003014194.1.93182 WP_003014194.1.95205 WP_003014194.1.95453 WP_003014194.1.95561 WP_003014194.1.95669 WP_003014194.1.9679 WP_003014194.1.96937 WP_003014194.1.97486 WP_003014194.1.98147 WP_003014194.1.99661 YP_169282.1.84429 119857.FTL_0182 177416.FTT_0229c 393011.FTH_0176 393115.FTF0229c 418136.FTW_1860 441952.FTM_1620 458234.FTA_0196 gi|423049928|ref|YP_007008362.1| gi|422938118|ref|YP_007011265.1| gi|110669857|ref|YP_666414.1| gi|385793990|ref|YP_005830396.1| gi|187932222|ref|YP_001892207.1| gi|379716582|ref|YP_005304918.1| gi|56707386|ref|YP_169282.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]