SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385794079|ref|YP_005830485.1| from Francisella tularensis subsp. tularensis NE061598

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385794079|ref|YP_005830485.1|
Domain Number 1 Region: 7-230
Classification Level Classification E-value
Superfamily Undecaprenyl diphosphate synthase 2.75e-77
Family Undecaprenyl diphosphate synthase 0.000000594
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|385794079|ref|YP_005830485.1|
Sequence length 240
Comment undecaprenyl diphosphate synthase [Francisella tularensis subsp. tularensis NE061598]
Sequence
MTSAKENILRHLAIIMDGNGRWAKSRLKPRIFGHRNSVSSVDATIEYCVENNIEMLTLFA
FGRDNWLRPAQEVSDLMDLFYKTLKDKTPKLHDNNIVVTVVGDRSRLSNKLIGMIEYSES
LTKSNTGLKLRLAVDYAGRWDIVEATRAIAREVDIGKLSVDEIDQNSFAKYLVGGNMPVD
LLIRTSGEVRLSDFMLWQLAYAEMYFTDIMWPDFSKQELTRAVEYFYSRQRRFGKSGEQI
Download sequence
Identical sequences A0A0B3VPZ0 A0A0E2ZSU6 A0A0H3TNA7
gi|134302593|ref|YP_001122564.1| gi|89255662|ref|YP_513023.1| gi|379725342|ref|YP_005317528.1| 119857.FTL_0228 418136.FTW_1765 441952.FTM_1535 gi|385794079|ref|YP_005830485.1| gi|187932151|ref|YP_001892136.1| gi|379716660|ref|YP_005304996.1| gi|379716738|ref|YP_005305074.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]