SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385794090|ref|YP_005830496.1| from Francisella tularensis subsp. tularensis NE061598

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385794090|ref|YP_005830496.1|
Domain Number 1 Region: 127-273
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 7.22e-64
Family C-terminal domain of ribosomal protein L2 0.000000821
Further Details:      
 
Domain Number 2 Region: 4-125
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 8.23e-47
Family Cold shock DNA-binding domain-like 0.0000236
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|385794090|ref|YP_005830496.1|
Sequence length 274
Comment 50S ribosomal protein L2 [Francisella tularensis subsp. tularensis NE061598]
Sequence
MIEIKKAKPTSPGRRHVVSVKNTELHTGKPFKGLVEVKKSKAGRNNTGRITVRHQGGGHK
QHYRIVDFKRNKDDITAKVERIEYDPNRSANIALVLYADGERRYIVAPKGLKKDMSVISG
EKVDVAVGNCMPLRNIPLGTVIHNIEMKPKKGAQMIRSAGTFAQLVGKDNAYAIIRLRSG
EMRRVLLDCRAVIGVVSNSEHNLKSLGKAGAKRWRGIRPTVRGVAMNPVDHPHGGGEGRT
SGGRHPVTPWGIPTKGYKTRRNKRSNKLIVQKRK
Download sequence
Identical sequences A0A0E2ZMC4 A0A0M1U5R8 A0A1I9Y7J0 A0A1J0KX45 A0A1S2WV57 A0Q4I6 A4IZT1 Q14JB7 Q5NHW5
gi|134302582|ref|YP_001122553.1| 177416.FTT_0328 393115.FTF0328 401614.FTN_0242 418136.FTW_1754 gi|56707481|ref|YP_169377.1| gi|118496855|ref|YP_897905.1| gi|379716671|ref|YP_005305007.1| gi|379716749|ref|YP_005305085.1| gi|110669952|ref|YP_666509.1| gi|385794090|ref|YP_005830496.1| gi|379725353|ref|YP_005317539.1| WP_003027197.1.101979 WP_003027197.1.10388 WP_003027197.1.11577 WP_003027197.1.11695 WP_003027197.1.17073 WP_003027197.1.17471 WP_003027197.1.1833 WP_003027197.1.19035 WP_003027197.1.2301 WP_003027197.1.26192 WP_003027197.1.26690 WP_003027197.1.31410 WP_003027197.1.35965 WP_003027197.1.36632 WP_003027197.1.3831 WP_003027197.1.38368 WP_003027197.1.38474 WP_003027197.1.38662 WP_003027197.1.39861 WP_003027197.1.42944 WP_003027197.1.43725 WP_003027197.1.44744 WP_003027197.1.47286 WP_003027197.1.52816 WP_003027197.1.53326 WP_003027197.1.5563 WP_003027197.1.56738 WP_003027197.1.5829 WP_003027197.1.59625 WP_003027197.1.59804 WP_003027197.1.60146 WP_003027197.1.61154 WP_003027197.1.64199 WP_003027197.1.65967 WP_003027197.1.66077 WP_003027197.1.66092 WP_003027197.1.66463 WP_003027197.1.67317 WP_003027197.1.69967 WP_003027197.1.70888 WP_003027197.1.72761 WP_003027197.1.75261 WP_003027197.1.76402 WP_003027197.1.77053 WP_003027197.1.78037 WP_003027197.1.80616 WP_003027197.1.82545 WP_003027197.1.87851 WP_003027197.1.89309 WP_003027197.1.98147 YP_169377.1.84429

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]