SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385794098|ref|YP_005830504.1| from Francisella tularensis subsp. tularensis NE061598

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385794098|ref|YP_005830504.1|
Domain Number 1 Region: 3-101
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 5.59e-30
Family Ribosomal proteins L24p and L21e 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|385794098|ref|YP_005830504.1|
Sequence length 105
Comment 50S ribosomal protein L24 [Francisella tularensis subsp. tularensis NE061598]
Sequence
MNRLKKGDDVIVIAGKDKGRRGVVKSFAKGGSLVLVEGINIVKKHIKPNPNRGIEDGVVE
KELPVDASNVAIFNPATEKADRVGYKFVDEKKVRYFKSNGELVDL
Download sequence
Identical sequences A0A0E2ZSZ0 A0A0M1U4Z9 A4IZS3 Q14JA9 Q5NHV7
gi|110669960|ref|YP_666517.1| 177416.FTT_0336 393115.FTF0336 418136.FTW_1747 gi|385794098|ref|YP_005830504.1| gi|56707489|ref|YP_169385.1| gi|379716678|ref|YP_005305014.1| gi|379716756|ref|YP_005305092.1| gi|379725360|ref|YP_005317546.1| gi|134302575|ref|YP_001122545.1| WP_003021594.1.101979 WP_003021594.1.10388 WP_003021594.1.11695 WP_003021594.1.17073 WP_003021594.1.17471 WP_003021594.1.1833 WP_003021594.1.19035 WP_003021594.1.2301 WP_003021594.1.25812 WP_003021594.1.26192 WP_003021594.1.26690 WP_003021594.1.31410 WP_003021594.1.35965 WP_003021594.1.36081 WP_003021594.1.3831 WP_003021594.1.38368 WP_003021594.1.38474 WP_003021594.1.38662 WP_003021594.1.39861 WP_003021594.1.42944 WP_003021594.1.44744 WP_003021594.1.47286 WP_003021594.1.52816 WP_003021594.1.53326 WP_003021594.1.5563 WP_003021594.1.56738 WP_003021594.1.5829 WP_003021594.1.59625 WP_003021594.1.60146 WP_003021594.1.61154 WP_003021594.1.65967 WP_003021594.1.66077 WP_003021594.1.66092 WP_003021594.1.66463 WP_003021594.1.67317 WP_003021594.1.75261 WP_003021594.1.77053 WP_003021594.1.78037 WP_003021594.1.80616 WP_003021594.1.82545 WP_003021594.1.87851 WP_003021594.1.98147 YP_169385.1.84429

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]