SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385794099|ref|YP_005830505.1| from Francisella tularensis subsp. tularensis NE061598

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385794099|ref|YP_005830505.1|
Domain Number 1 Region: 3-178
Classification Level Classification E-value
Superfamily RL5-like 2.83e-76
Family Ribosomal protein L5 0.000000196
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|385794099|ref|YP_005830505.1|
Sequence length 179
Comment 50S ribosomal protein L5 [Francisella tularensis subsp. tularensis NE061598]
Sequence
MARLKDYYQKELVAKLKTELGLDNIMEVPTIKKITLNMGVGDAAKDKKIMTFALNDLTAI
AGQKPVVTKSKKSIAGFKIRDGWPIGAKVTLRGDRMYEFLDRLITIAIPRIRDFRGLSAK
SFDGRGNYSLGMREQISFPEIDYDKVDSIRGLDISITTTAKNDDQGRALLKAFGFPFKS
Download sequence
Identical sequences A0A0E2ZSX8 A0A0H3TNV1 Q14JA8 Q5NHV6
gi|379716679|ref|YP_005305015.1| gi|379716757|ref|YP_005305093.1| gi|56707490|ref|YP_169386.1| gi|110669961|ref|YP_666518.1| gi|385794099|ref|YP_005830505.1| WP_003021592.1.101979 WP_003021592.1.10388 WP_003021592.1.11695 WP_003021592.1.1833 WP_003021592.1.19035 WP_003021592.1.2301 WP_003021592.1.25812 WP_003021592.1.31410 WP_003021592.1.35965 WP_003021592.1.36081 WP_003021592.1.3831 WP_003021592.1.38368 WP_003021592.1.38474 WP_003021592.1.38662 WP_003021592.1.44744 WP_003021592.1.52816 WP_003021592.1.56738 WP_003021592.1.5829 WP_003021592.1.59625 WP_003021592.1.60146 WP_003021592.1.61154 WP_003021592.1.65967 WP_003021592.1.66077 WP_003021592.1.66092 WP_003021592.1.67317 WP_003021592.1.75261 WP_003021592.1.77053 WP_003021592.1.80616 WP_003021592.1.82545 WP_003021592.1.87851 WP_003021592.1.98147 YP_169386.1.84429 177416.FTT_0337 393115.FTF0337 gi|379725361|ref|YP_005317547.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]