SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385794109|ref|YP_005830515.1| from Francisella tularensis subsp. tularensis NE061598

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385794109|ref|YP_005830515.1|
Domain Number 1 Region: 2-114
Classification Level Classification E-value
Superfamily S13-like H2TH domain 1.15e-45
Family Ribosomal protein S13 0.0000126
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|385794109|ref|YP_005830515.1|
Sequence length 118
Comment 30S ribosomal protein S13 [Francisella tularensis subsp. tularensis NE061598]
Sequence
MARIAGVNIPVHKHTVIGLTSIYGIGKTRAQQICQTCNVDPTVKIKDLSEEQVESLRTEV
AKFTVEGDLRREVSMDIKRLMDLGCFRGRRHRRSLPVRGQRTKTNARTRKGPRKPIKA
Download sequence
Identical sequences A0A0B3VDK6 A0A0E3A7M8 A0A0H3TN49 A0A1I9Y7K9 A0A1J0L0G4 A0A1S2WTE4 A0Q4K5 A4IZR2 A7N9U6 B2SDW3 Q0BNQ6 Q14J98 Q2A5E8 Q5NHU6
gi|115314192|ref|YP_762915.1| gi|385792197|ref|YP_005825173.1| 119857.FTL_0258 177416.FTT_0347 393011.FTH_0253 393115.FTF0347 401614.FTN_0261 418136.FTW_1736 441952.FTM_1505 458234.FTA_0272 gi|385794109|ref|YP_005830515.1| gi|187932121|ref|YP_001892106.1| gi|422938188|ref|YP_007011335.1| gi|423050002|ref|YP_007008436.1| gi|134302564|ref|YP_001122534.1| gi|379716689|ref|YP_005305025.1| gi|379716767|ref|YP_005305103.1| gi|56707500|ref|YP_169396.1| gi|89255692|ref|YP_513053.1| gi|110669971|ref|YP_666528.1| WP_003014373.1.100020 WP_003014373.1.100480 WP_003014373.1.100639 WP_003014373.1.101979 WP_003014373.1.10388 WP_003014373.1.11004 WP_003014373.1.11577 WP_003014373.1.11695 WP_003014373.1.12700 WP_003014373.1.12820 WP_003014373.1.13116 WP_003014373.1.1316 WP_003014373.1.13715 WP_003014373.1.13896 WP_003014373.1.1431 WP_003014373.1.15828 WP_003014373.1.17073 WP_003014373.1.17117 WP_003014373.1.17471 WP_003014373.1.18135 WP_003014373.1.1833 WP_003014373.1.19035 WP_003014373.1.19348 WP_003014373.1.21553 WP_003014373.1.21561 WP_003014373.1.2186 WP_003014373.1.2301 WP_003014373.1.24109 WP_003014373.1.24307 WP_003014373.1.2436 WP_003014373.1.25474 WP_003014373.1.25812 WP_003014373.1.26192 WP_003014373.1.26690 WP_003014373.1.27183 WP_003014373.1.27408 WP_003014373.1.28031 WP_003014373.1.28288 WP_003014373.1.30377 WP_003014373.1.31247 WP_003014373.1.3134 WP_003014373.1.31410 WP_003014373.1.31907 WP_003014373.1.33374 WP_003014373.1.34036 WP_003014373.1.35898 WP_003014373.1.35965 WP_003014373.1.36081 WP_003014373.1.36125 WP_003014373.1.36481 WP_003014373.1.36632 WP_003014373.1.37362 WP_003014373.1.37819 WP_003014373.1.38195 WP_003014373.1.3831 WP_003014373.1.38368 WP_003014373.1.38474 WP_003014373.1.38662 WP_003014373.1.38763 WP_003014373.1.3975 WP_003014373.1.39861 WP_003014373.1.40634 WP_003014373.1.40692 WP_003014373.1.41167 WP_003014373.1.42944 WP_003014373.1.43575 WP_003014373.1.43725 WP_003014373.1.43882 WP_003014373.1.44313 WP_003014373.1.44744 WP_003014373.1.44922 WP_003014373.1.45210 WP_003014373.1.45908 WP_003014373.1.4633 WP_003014373.1.46791 WP_003014373.1.46956 WP_003014373.1.47286 WP_003014373.1.47340 WP_003014373.1.48020 WP_003014373.1.48098 WP_003014373.1.48962 WP_003014373.1.50994 WP_003014373.1.51529 WP_003014373.1.52816 WP_003014373.1.53326 WP_003014373.1.5414 WP_003014373.1.54420 WP_003014373.1.5487 WP_003014373.1.54961 WP_003014373.1.55289 WP_003014373.1.5563 WP_003014373.1.56738 WP_003014373.1.57478 WP_003014373.1.5829 WP_003014373.1.59625 WP_003014373.1.59804 WP_003014373.1.59871 WP_003014373.1.5992 WP_003014373.1.60112 WP_003014373.1.60146 WP_003014373.1.60504 WP_003014373.1.61154 WP_003014373.1.63091 WP_003014373.1.63562 WP_003014373.1.64199 WP_003014373.1.64987 WP_003014373.1.65566 WP_003014373.1.65967 WP_003014373.1.66025 WP_003014373.1.66077 WP_003014373.1.66092 WP_003014373.1.66463 WP_003014373.1.67317 WP_003014373.1.6752 WP_003014373.1.68327 WP_003014373.1.69118 WP_003014373.1.69545 WP_003014373.1.69933 WP_003014373.1.69967 WP_003014373.1.70888 WP_003014373.1.7106 WP_003014373.1.72408 WP_003014373.1.72665 WP_003014373.1.72761 WP_003014373.1.73228 WP_003014373.1.73973 WP_003014373.1.74506 WP_003014373.1.74697 WP_003014373.1.75261 WP_003014373.1.76402 WP_003014373.1.77053 WP_003014373.1.77714 WP_003014373.1.77892 WP_003014373.1.78037 WP_003014373.1.78521 WP_003014373.1.80474 WP_003014373.1.80603 WP_003014373.1.80616 WP_003014373.1.82216 WP_003014373.1.8254 WP_003014373.1.82545 WP_003014373.1.83968 WP_003014373.1.84288 WP_003014373.1.84370 WP_003014373.1.85044 WP_003014373.1.85695 WP_003014373.1.85899 WP_003014373.1.87224 WP_003014373.1.87451 WP_003014373.1.87851 WP_003014373.1.88243 WP_003014373.1.89268 WP_003014373.1.89309 WP_003014373.1.90324 WP_003014373.1.91892 WP_003014373.1.92567 WP_003014373.1.93025 WP_003014373.1.93182 WP_003014373.1.95205 WP_003014373.1.95453 WP_003014373.1.95561 WP_003014373.1.95669 WP_003014373.1.9679 WP_003014373.1.96937 WP_003014373.1.97486 WP_003014373.1.98147 WP_003014373.1.99661 YP_169396.1.84429 gi|118496874|ref|YP_897924.1| gi|156501640|ref|YP_001427705.1| gi|379725371|ref|YP_005317557.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]