SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385794403|ref|YP_005830809.1| from Francisella tularensis subsp. tularensis NE061598

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385794403|ref|YP_005830809.1|
Domain Number 1 Region: 10-341
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.79e-81
Family Tandem AAA-ATPase domain 0.0000143
Further Details:      
 
Domain Number 2 Region: 519-777
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.03e-59
Family Tandem AAA-ATPase domain 0.000000212
Further Details:      
 
Domain Number 3 Region: 776-983
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.09e-46
Family Tandem AAA-ATPase domain 0.000000154
Further Details:      
 
Domain Number 4 Region: 997-1140
Classification Level Classification E-value
Superfamily TRCF domain-like 1.07e-35
Family TRCF domain 0.0000858
Further Details:      
 
Domain Number 5 Region: 468-542
Classification Level Classification E-value
Superfamily CarD-like 9.15e-21
Family CarD-like 0.00023
Further Details:      
 
Domain Number 6 Region: 350-456
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000000223
Family Tandem AAA-ATPase domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|385794403|ref|YP_005830809.1|
Sequence length 1141
Comment Transcription-repair coupling factor,ATP-dependent [Francisella tularensis subsp. tularensis NE061598]
Sequence
MLNNQISANDTVVSNAYGSAFSILFNEYLKQNNQFNLIVTEDSQQAHKIYKELKYLNKNN
SKVDILFFPNLEILPYDRFSASIDIISRRQEILYKMTHQPQKTLIITSISNTLRKIAPAS
FIQKHSFILKTGDNLDITKYKMLLTEAGYTLVNNVFEKGEFSIRGSIIDIYPIGSKVAFR
IDLFDNEIDSIKELNTESQRSGNQIQSINIMPSHELVYNNQNTTFALDKLNKLCGDKALN
STIATYIQNNEYFSGIEFYLPLFYDKLSSLYDYLPPSTNIHLVDNITNSIEAFSDEVKFR
YNELKHDSDRPILPFQEIFYSQQEIQDIYQQYKNIKWFQQPKSKSKILKVDHLEKISANY
KLANPFKDLQQFIDKSNFDKVIFSTDSNGRAELLLEHLNKLNLNIQSCKNFNEAIEVSAK
FCLIISPFQEGMIIDKKIALITEADLFPEHGYNSTKVSQHDHHPTVDLKDLTDLKPGMHV
VHIDHGIGRYEGLESIELNGKKDEFILLRYANDAKIYVPITSLNLISIYNSSLTEKIALN
KLGTDKWKKQKEKTIKKIIDVAANLLEIYAKREMRQGFSNSLDEEEYLRFCADFPYEETP
DQLSAINDVFKDMISAKPMDRLICGDVGFGKTEIAMRAAFLATQNQKQVAILVPTTILAQ
QHYNSFKDRFTNTAFNIEVITRSKTPKAQQQLFEDLKKGTIDIIIGTHKLISSKIDFKNL
GLLIIDEEHRFGVAQKEKLKSLKAEIDILTMSATPIPRSLSMAFSALRDLSIIASPPAKR
LSVKTFVKEYDNNIIREAVSRETIRGGQIFYLYNKVETIQKKKEILQELFPRLRIAIAHG
QMSEKEIQKVMFDFKHNKYHILLCTTIIETGIDIPNANTLIIEDANNLGLAQLHQLRGRV
GRSHHQAYAYMLIPNEASITKDALKRLEAISNTESLGGGFTLANHDLEIRGAGEILGEEQ
SGNIDGIGLNLYMDLLDKTIANLRAGKKLNIEEVINSTVCEVELNIPTLIPDYYIYDVNT
RLNIYKRISKASHQDLVNIKIELIDRFGKLPLEVLYLLKVAHIKIDAIALGISQIKMFAT
SGKISFSNNTKFEPQKLIKLIQSQPSDFRLTKEHDLIITKVTKTAEQRIEFIENFLKKIV
Q
Download sequence
Identical sequences A0A0E3A4M5 A0A0G2RN90 Q5NH30
WP_003023453.1.11695 WP_003023453.1.1833 WP_003023453.1.19035 WP_003023453.1.2301 WP_003023453.1.25812 WP_003023453.1.31410 WP_003023453.1.35965 WP_003023453.1.3831 WP_003023453.1.38368 WP_003023453.1.38474 WP_003023453.1.38662 WP_003023453.1.40634 WP_003023453.1.44744 WP_003023453.1.52816 WP_003023453.1.56738 WP_003023453.1.5829 WP_003023453.1.59625 WP_003023453.1.60146 WP_003023453.1.61154 WP_003023453.1.65967 WP_003023453.1.66077 WP_003023453.1.66092 WP_003023453.1.67317 WP_003023453.1.75261 WP_003023453.1.77053 WP_003023453.1.80616 WP_003023453.1.82545 WP_003023453.1.87851 WP_003023453.1.98147 YP_169662.1.84429 gi|385794403|ref|YP_005830809.1| gi|379725620|ref|YP_005317806.1| gi|379717016|ref|YP_005305352.1| 177416.FTT_0644c 393115.FTF0644c gi|56707766|ref|YP_169662.1| gi|110670237|ref|YP_666794.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]