SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385794454|ref|YP_005830860.1| from Francisella tularensis subsp. tularensis NE061598

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385794454|ref|YP_005830860.1|
Domain Number 1 Region: 2-139
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 1.83e-33
Family N-terminal domain of MutM-like DNA repair proteins 0.0001
Further Details:      
 
Domain Number 2 Region: 135-227
Classification Level Classification E-value
Superfamily S13-like H2TH domain 4.56e-26
Family Middle domain of MutM-like DNA repair proteins 0.00069
Further Details:      
 
Domain Number 3 Region: 222-274
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.56e-16
Family C-terminal, Zn-finger domain of MutM-like DNA repair proteins 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|385794454|ref|YP_005830860.1|
Sequence length 274
Comment formamidopyrimidine-DNA glycosylase [Francisella tularensis subsp. tularensis NE061598]
Sequence
MPELPEVETVKRGLIKTIIDKKIFDIEINTDKLRYPIDKDQLVKIKNKVVKEIQRRGKHL
IIFIEDDLQLIIHLGMSGIIKVIDSTNYNKIKHDHIVVTLSDNLSLVYNDPRKFGYWLVN
TNHTPLEHRVLVSHGVEPLTADFNSDYLVSKLKQTSRKIKQTIMDNNIVVGVGNIYASEA
LFDSNILPTRASNTITKKEAANLVSSIKKILEKAITQGGTTLKDYKNTEGKPGYFTQQLN
VYGRNEQQCYVCNTKIQSLVIAQRNTFFCKKCQK
Download sequence
Identical sequences A0A0B6DZP1 A0A0E2ZLV6 A0A0H3TN58 A0Q5I3 Q5NGY3
gi|115315213|ref|YP_763936.1| gi|56707813|ref|YP_169709.1| gi|89256827|ref|YP_514189.1| gi|110670284|ref|YP_666841.1| gi|385794454|ref|YP_005830860.1| gi|422939131|ref|YP_007012278.1| WP_003016895.1.100020 WP_003016895.1.101979 WP_003016895.1.10388 WP_003016895.1.11577 WP_003016895.1.11695 WP_003016895.1.12700 WP_003016895.1.12820 WP_003016895.1.1316 WP_003016895.1.13715 WP_003016895.1.15828 WP_003016895.1.17073 WP_003016895.1.17117 WP_003016895.1.17471 WP_003016895.1.1833 WP_003016895.1.19035 WP_003016895.1.21553 WP_003016895.1.21561 WP_003016895.1.2301 WP_003016895.1.2436 WP_003016895.1.25812 WP_003016895.1.26192 WP_003016895.1.26690 WP_003016895.1.28031 WP_003016895.1.28288 WP_003016895.1.30377 WP_003016895.1.31247 WP_003016895.1.3134 WP_003016895.1.31410 WP_003016895.1.31907 WP_003016895.1.34036 WP_003016895.1.35965 WP_003016895.1.36081 WP_003016895.1.37362 WP_003016895.1.37819 WP_003016895.1.3831 WP_003016895.1.38474 WP_003016895.1.38662 WP_003016895.1.39861 WP_003016895.1.40634 WP_003016895.1.40692 WP_003016895.1.42944 WP_003016895.1.43575 WP_003016895.1.44313 WP_003016895.1.44744 WP_003016895.1.44922 WP_003016895.1.45210 WP_003016895.1.47286 WP_003016895.1.48098 WP_003016895.1.48962 WP_003016895.1.50994 WP_003016895.1.52816 WP_003016895.1.53326 WP_003016895.1.5414 WP_003016895.1.54420 WP_003016895.1.54961 WP_003016895.1.55289 WP_003016895.1.5563 WP_003016895.1.56738 WP_003016895.1.5829 WP_003016895.1.59625 WP_003016895.1.5992 WP_003016895.1.60146 WP_003016895.1.61154 WP_003016895.1.64987 WP_003016895.1.65566 WP_003016895.1.65967 WP_003016895.1.66077 WP_003016895.1.66092 WP_003016895.1.66463 WP_003016895.1.67317 WP_003016895.1.68327 WP_003016895.1.72761 WP_003016895.1.73973 WP_003016895.1.75261 WP_003016895.1.77053 WP_003016895.1.77714 WP_003016895.1.77892 WP_003016895.1.78037 WP_003016895.1.80474 WP_003016895.1.80603 WP_003016895.1.80616 WP_003016895.1.82216 WP_003016895.1.82545 WP_003016895.1.84288 WP_003016895.1.84370 WP_003016895.1.85044 WP_003016895.1.87851 WP_003016895.1.90324 WP_003016895.1.92567 WP_003016895.1.93025 WP_003016895.1.95205 WP_003016895.1.96937 WP_003016895.1.98147 WP_003016895.1.99661 YP_169709.1.84429 gi|379725665|ref|YP_005317851.1| gi|379717061|ref|YP_005305397.1| IDP04641 gi|118497202|ref|YP_898252.1| gi|134302414|ref|YP_001122384.1| 119857.FTL_1543 177416.FTT_0693c 393011.FTH_1493 393115.FTF0693c 401614.FTN_0603 418136.FTW_1550

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]