SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385794534|ref|YP_005830940.1| from Francisella tularensis subsp. tularensis NE061598

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385794534|ref|YP_005830940.1|
Domain Number 1 Region: 2-80
Classification Level Classification E-value
Superfamily Ribosomal L27 protein-like 5.58e-34
Family Ribosomal L27 protein 0.0000525
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|385794534|ref|YP_005830940.1|
Sequence length 84
Comment 50S ribosomal protein L27 [Francisella tularensis subsp. tularensis NE061598]
Sequence
MAHKKAGGSTRNGRDSNPKYLGVKRYGGEFVKAGTIIIRQRGTKTHPGVNVGCGKDHTLF
ALKDGTVKFHTGGALNRKFVSIEE
Download sequence
Identical sequences A0A0E2ZM59 A0A0M1U4D7 A0A1I9Y8V9 A0A1J0KH29 A0A1J0KPZ7 A0A1S2WU53 A0Q5Q3 A4IZ44 B2SDE7 Q14I63 Q5NGR1
gi|56707885|ref|YP_169781.1| gi|379717131|ref|YP_005305467.1| gi|385792615|ref|YP_005825591.1| gi|110670356|ref|YP_666913.1| gi|379725735|ref|YP_005317921.1| 177416.FTT_0773 393115.FTF0773 401614.FTN_0676 418136.FTW_1465 441952.FTM_1315 gi|187931955|ref|YP_001891940.1| gi|118497272|ref|YP_898322.1| gi|385794534|ref|YP_005830940.1| gi|134302347|ref|YP_001122316.1| WP_003020646.1.101979 WP_003020646.1.10388 WP_003020646.1.11577 WP_003020646.1.11695 WP_003020646.1.17073 WP_003020646.1.17471 WP_003020646.1.1833 WP_003020646.1.19035 WP_003020646.1.21561 WP_003020646.1.2301 WP_003020646.1.25812 WP_003020646.1.26192 WP_003020646.1.26690 WP_003020646.1.31410 WP_003020646.1.35965 WP_003020646.1.36081 WP_003020646.1.36632 WP_003020646.1.3831 WP_003020646.1.38368 WP_003020646.1.38474 WP_003020646.1.38662 WP_003020646.1.39861 WP_003020646.1.40634 WP_003020646.1.42944 WP_003020646.1.43725 WP_003020646.1.44744 WP_003020646.1.47286 WP_003020646.1.51191 WP_003020646.1.52816 WP_003020646.1.53326 WP_003020646.1.5563 WP_003020646.1.56738 WP_003020646.1.5829 WP_003020646.1.59625 WP_003020646.1.59804 WP_003020646.1.60146 WP_003020646.1.61154 WP_003020646.1.64199 WP_003020646.1.65967 WP_003020646.1.66025 WP_003020646.1.66077 WP_003020646.1.66092 WP_003020646.1.66463 WP_003020646.1.67317 WP_003020646.1.69967 WP_003020646.1.70888 WP_003020646.1.72761 WP_003020646.1.75261 WP_003020646.1.76402 WP_003020646.1.77053 WP_003020646.1.78037 WP_003020646.1.80616 WP_003020646.1.82545 WP_003020646.1.87851 WP_003020646.1.89268 WP_003020646.1.89309 WP_003020646.1.91892 WP_003020646.1.92567 WP_003020646.1.95561 WP_003020646.1.98147 YP_169781.1.84429

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]