SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385794635|ref|YP_005831041.1| from Francisella tularensis subsp. tularensis NE061598

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385794635|ref|YP_005831041.1|
Domain Number 1 Region: 40-183
Classification Level Classification E-value
Superfamily Cu,Zn superoxide dismutase-like 5.76e-40
Family Cu,Zn superoxide dismutase-like 0.00000338
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|385794635|ref|YP_005831041.1|
Sequence length 185
Comment copper/zinc superoxide dismutase [Francisella tularensis subsp. tularensis NE061598]
Sequence
MTAFYKLCGMSMLSLVLADCTFLSANKPYDRDHDGELIVHMKDVNTHKEVGTITISPYIH
DGNQEGMLITPHLYNLPANTTHGMHIHINPSCEDNGIAAGGHWDPDNTQKHLGPYNDNGH
KGDLPVLVVNADGTATEPVVAPKLNSLEELAGHSLMLHAGGDNYSDKPQPLGGGGARMWC
GVIAD
Download sequence
Identical sequences A0A0B6E3F7 A0A0E3A354 A0A0G2RMJ6 Q59448 Q5NGG3
119857.FTL_0380 177416.FTT_0879 393011.FTH_0373 393115.FTF0879 418136.FTW_1301 441952.FTM_0468 458234.FTA_0403 gi|115314287|ref|YP_763010.1| gi|187931283|ref|YP_001891267.1| gi|110670454|ref|YP_667011.1| gi|379717224|ref|YP_005305560.1| gi|422938270|ref|YP_007011417.1| gi|385794635|ref|YP_005831041.1| gi|379725828|ref|YP_005318014.1| gi|156501771|ref|YP_001427836.1| IDP02677 gi|134302227|ref|YP_001122196.1| WP_003014586.1.100020 WP_003014586.1.100480 WP_003014586.1.100639 WP_003014586.1.101979 WP_003014586.1.10388 WP_003014586.1.11004 WP_003014586.1.11695 WP_003014586.1.12700 WP_003014586.1.12820 WP_003014586.1.13116 WP_003014586.1.1316 WP_003014586.1.13715 WP_003014586.1.13896 WP_003014586.1.1431 WP_003014586.1.15828 WP_003014586.1.17073 WP_003014586.1.17117 WP_003014586.1.17471 WP_003014586.1.18135 WP_003014586.1.1833 WP_003014586.1.19035 WP_003014586.1.19348 WP_003014586.1.21553 WP_003014586.1.2186 WP_003014586.1.2301 WP_003014586.1.24109 WP_003014586.1.24307 WP_003014586.1.2436 WP_003014586.1.25474 WP_003014586.1.25812 WP_003014586.1.26192 WP_003014586.1.26690 WP_003014586.1.27183 WP_003014586.1.27408 WP_003014586.1.28031 WP_003014586.1.28288 WP_003014586.1.30377 WP_003014586.1.31247 WP_003014586.1.3134 WP_003014586.1.31410 WP_003014586.1.31907 WP_003014586.1.33374 WP_003014586.1.34036 WP_003014586.1.35898 WP_003014586.1.35965 WP_003014586.1.36081 WP_003014586.1.36125 WP_003014586.1.36481 WP_003014586.1.37362 WP_003014586.1.38195 WP_003014586.1.3831 WP_003014586.1.38368 WP_003014586.1.38474 WP_003014586.1.38662 WP_003014586.1.38763 WP_003014586.1.3975 WP_003014586.1.39861 WP_003014586.1.40634 WP_003014586.1.40692 WP_003014586.1.41167 WP_003014586.1.42944 WP_003014586.1.43575 WP_003014586.1.43882 WP_003014586.1.44313 WP_003014586.1.44744 WP_003014586.1.44922 WP_003014586.1.45908 WP_003014586.1.46791 WP_003014586.1.46956 WP_003014586.1.47286 WP_003014586.1.47340 WP_003014586.1.48020 WP_003014586.1.48098 WP_003014586.1.48962 WP_003014586.1.51529 WP_003014586.1.52816 WP_003014586.1.53326 WP_003014586.1.54420 WP_003014586.1.5487 WP_003014586.1.54961 WP_003014586.1.55289 WP_003014586.1.5563 WP_003014586.1.56738 WP_003014586.1.57478 WP_003014586.1.5829 WP_003014586.1.59625 WP_003014586.1.59871 WP_003014586.1.5992 WP_003014586.1.60112 WP_003014586.1.60146 WP_003014586.1.60504 WP_003014586.1.61154 WP_003014586.1.63091 WP_003014586.1.63562 WP_003014586.1.64987 WP_003014586.1.65566 WP_003014586.1.65967 WP_003014586.1.66077 WP_003014586.1.66092 WP_003014586.1.66463 WP_003014586.1.67317 WP_003014586.1.6752 WP_003014586.1.68327 WP_003014586.1.69545 WP_003014586.1.69933 WP_003014586.1.7106 WP_003014586.1.72408 WP_003014586.1.72665 WP_003014586.1.73228 WP_003014586.1.73973 WP_003014586.1.74506 WP_003014586.1.74697 WP_003014586.1.75261 WP_003014586.1.77053 WP_003014586.1.77714 WP_003014586.1.77892 WP_003014586.1.78037 WP_003014586.1.78521 WP_003014586.1.80603 WP_003014586.1.80616 WP_003014586.1.82216 WP_003014586.1.8254 WP_003014586.1.82545 WP_003014586.1.83968 WP_003014586.1.84288 WP_003014586.1.84370 WP_003014586.1.85044 WP_003014586.1.85695 WP_003014586.1.85899 WP_003014586.1.87224 WP_003014586.1.87451 WP_003014586.1.87851 WP_003014586.1.88243 WP_003014586.1.90324 WP_003014586.1.93025 WP_003014586.1.93182 WP_003014586.1.95205 WP_003014586.1.95453 WP_003014586.1.95561 WP_003014586.1.95669 WP_003014586.1.9679 WP_003014586.1.96937 WP_003014586.1.97486 WP_003014586.1.98147 WP_003014586.1.99661 YP_169879.1.84429 gi|89255794|ref|YP_513156.1| gi|423050118|ref|YP_007008552.1| gi|56707983|ref|YP_169879.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]