SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385794718|ref|YP_005831124.1| from Francisella tularensis subsp. tularensis NE061598

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385794718|ref|YP_005831124.1|
Domain Number 1 Region: 42-354
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.91e-53
Family Nitrogenase iron protein-like 0.0000127
Further Details:      
 
Domain Number 2 Region: 298-426
Classification Level Classification E-value
Superfamily Signal peptide-binding domain 7.19e-41
Family Signal peptide-binding domain 0.0000754
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|385794718|ref|YP_005831124.1|
Sequence length 458
Comment signal recognition particle protein, Ffh [Francisella tularensis subsp. tularensis NE061598]
Sequence
MFTSLSEKLQSSFKKIKGQTSLTEENIQSALRDIRVSLLEADVALPVVKKFIANIKEKAI
GEEVKKSLTPDQTFISFVKKEIEKALGEEAVPINLKTQPPAVILMAGLQGAGKTTSTAKL
AKYLKEQHNKKVMVVSADVYRPAAIDQLRTLANSLNVEFFKSDASQQPEDIVTAAIKTAK
TKLIDVLIIDTAGRLHIDNDMMDEIKQIHKIAKPIETFFTVDSMTGQDAAVTAKAFNDAL
ELTGVILTKTDGDARGGAALSIREITGKPIKFLGVGEKTDALEPFHPDRVASKILGMGDV
LSLIESIEQKTEKKSAEQLTKKLKSGKSFDLEDFKAQIQQMKKMGGVGSIMSKLPNMPAN
LPGDVGDDMFKKIEAMIDSMTPLERKKPELIKHSRKQRIIKGSGTTIQDLNKLLQQHTQI
KKMMKSVIGKKGGMANLMKRMSAMQGMANMPGLFGKRK
Download sequence
Identical sequences A0A0E2ZMD7 A0A0G2RMC2 Q5NG88
gi|385794718|ref|YP_005831124.1| gi|379717299|ref|YP_005305635.1| gi|110670529|ref|YP_667086.1| gi|379725903|ref|YP_005318089.1| gi|56708058|ref|YP_169954.1| WP_003021039.1.101979 WP_003021039.1.10388 WP_003021039.1.11695 WP_003021039.1.1833 WP_003021039.1.19035 WP_003021039.1.2301 WP_003021039.1.25812 WP_003021039.1.31410 WP_003021039.1.35965 WP_003021039.1.36081 WP_003021039.1.3831 WP_003021039.1.38368 WP_003021039.1.38474 WP_003021039.1.38662 WP_003021039.1.40634 WP_003021039.1.44744 WP_003021039.1.52816 WP_003021039.1.56738 WP_003021039.1.5829 WP_003021039.1.59625 WP_003021039.1.60146 WP_003021039.1.61154 WP_003021039.1.65967 WP_003021039.1.66077 WP_003021039.1.66092 WP_003021039.1.67317 WP_003021039.1.75261 WP_003021039.1.77053 WP_003021039.1.80616 WP_003021039.1.82545 WP_003021039.1.87851 WP_003021039.1.98147 YP_169954.1.84429 177416.FTT_0964c 393115.FTF0964c IDP02208

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]