SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385794971|ref|YP_005831377.1| from Francisella tularensis subsp. tularensis NE061598

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385794971|ref|YP_005831377.1|
Domain Number 1 Region: 4-338
Classification Level Classification E-value
Superfamily QueA-like 7.72e-132
Family QueA-like 0.000000034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|385794971|ref|YP_005831377.1|
Sequence length 338
Comment S-adenosylmethionine--tRNA ribosyltransferase-isomerase [Francisella tularensis subsp. tularensis NE061598]
Sequence
MKTDDFDYKLPEELIASYPLENRDASRLLKLNKQTGEIADYKFTDFIDFINPGDLLVFNN
SKVMLARLYGSKTTGAKLEYLIERIKTPKLFETHIKANRSPAIGSEIYVEDTLAKVLDKD
GGMYLLEIQGDKDIYQLMEEFGHIPLPPYMKRDDEEFDAERYQTVYAQDLGSVAAPTAGL
HFSKELMQQIKDKGVDIAYITLHVGSGTFKPVQVDDVESHKMHAEVISVPVEVCQKIRQT
KENGGRVIAIGTTSVRSLETAGQNGQIEPYQGETDIFLYPGKKFNVVDAMITNFHLPKST
LIMLVSAFADKEKIIKAYEHAIAERYRFFSYGDAMFIF
Download sequence
Identical sequences A0A0E2ZH93 A0A0M1U4A6
WP_003023807.1.101979 WP_003023807.1.10388 WP_003023807.1.11695 WP_003023807.1.1833 WP_003023807.1.19035 WP_003023807.1.2301 WP_003023807.1.25812 WP_003023807.1.31410 WP_003023807.1.35965 WP_003023807.1.36081 WP_003023807.1.3831 WP_003023807.1.38368 WP_003023807.1.38474 WP_003023807.1.38662 WP_003023807.1.40634 WP_003023807.1.44744 WP_003023807.1.52816 WP_003023807.1.56738 WP_003023807.1.5829 WP_003023807.1.59625 WP_003023807.1.60146 WP_003023807.1.61154 WP_003023807.1.65967 WP_003023807.1.66077 WP_003023807.1.66092 WP_003023807.1.67317 WP_003023807.1.75261 WP_003023807.1.77053 WP_003023807.1.80616 WP_003023807.1.82545 WP_003023807.1.87851 WP_003023807.1.98147 gi|379726117|ref|YP_005318303.1| gi|385794971|ref|YP_005831377.1| gi|379717513|ref|YP_005305849.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]