SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385794987|ref|YP_005831393.1| from Francisella tularensis subsp. tularensis NE061598

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385794987|ref|YP_005831393.1|
Domain Number 1 Region: 108-295
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 6.19e-51
Family Formate/glycerate dehydrogenases, NAD-domain 0.00000106
Further Details:      
 
Domain Number 2 Region: 8-134
Classification Level Classification E-value
Superfamily Formate/glycerate dehydrogenase catalytic domain-like 1.15e-42
Family Formate/glycerate dehydrogenases, substrate-binding domain 0.0000363
Further Details:      
 
Domain Number 3 Region: 335-410
Classification Level Classification E-value
Superfamily ACT-like 6.66e-16
Family Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|385794987|ref|YP_005831393.1|
Sequence length 411
Comment D-3-phosphoglycerate dehydrogenase [Francisella tularensis subsp. tularensis NE061598]
Sequence
MSQLSLNKKKIPILLLEGIHSNAVESFKAAGYENIELLNTALEGQELIDKLKDFKIVGLR
SRTQLIKEVLEQSDHLIAIGCFCIGTNQVDLKTAQSLGIPVFNAPFSNTRSVAELVLAEA
ILLIRNVIDKNAKAHRGEWLKSADNANEVRGKTLGIVGYGHIGMQLGVLAENIGLNVIFY
DIEEKLPLGNACQVDSLATLLQQSDVVSLHVPQLPTTANMISTKEFALMKQNAVLINASR
GNVIDIDALVDALTSSKLKGAAIDVFPKEPSSKGEIFESPLTGLDNVFLTLHIGGSTIEA
QENIATEVSAKLIKYSDNGSTLNAVNFPELSLPSHRETHRILHIHQNIPGIINELNRILA
SKNINVEGQYLRTLENIGYVVMDIKSSSDEAKELIDEFKKVKATIKARYLV
Download sequence
Identical sequences A0A0E2ZHP1 A0A0M1U4N1
gi|379726132|ref|YP_005318318.1| gi|385794987|ref|YP_005831393.1| gi|379717528|ref|YP_005305864.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]