SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385795093|ref|YP_005831499.1| from Francisella tularensis subsp. tularensis NE061598

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385795093|ref|YP_005831499.1|
Domain Number 1 Region: 17-326
Classification Level Classification E-value
Superfamily DNA ligase/mRNA capping enzyme, catalytic domain 7.02e-102
Family Adenylation domain of NAD+-dependent DNA ligase 0.000000457
Further Details:      
 
Domain Number 2 Region: 413-593
Classification Level Classification E-value
Superfamily RuvA domain 2-like 2.89e-57
Family NAD+-dependent DNA ligase, domain 3 0.0000784
Further Details:      
 
Domain Number 3 Region: 328-410
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.88e-27
Family DNA ligase/mRNA capping enzyme postcatalytic domain 0.00092
Further Details:      
 
Domain Number 4 Region: 604-677
Classification Level Classification E-value
Superfamily BRCT domain 1.6e-18
Family DNA ligase 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|385795093|ref|YP_005831499.1|
Sequence length 678
Comment NAD-dependent DNA ligase [Francisella tularensis subsp. tularensis NE061598]
Sequence
MTPNEFFSIKYHILAKAELKAYIDKLADYLSQQSYLYHTLDKPIISDSDYDKLFRLLQDL
VNDNPQFKPINSVLDRVGGEVLAGFETIKHKKKMTSLANVFSLEELRDFYDKIEYDIELE
CEPKMDGLAISIFYKNGKFDYAVTRGDGIQGEKVSENVKTIRNVPLKLNTSNPPEELEVR
GEIILDKQSFLSLNEYMQTHENKTFANPRNAAAGSIRMLDSKVVAKRPLKLYSYGIGYFS
KDFVYPETQFELMQLLQSFGFTISDNMFLAKNFSEVEEYHHKMSHQRADLAYDIDGLVFK
VNNIKLQDTIGYTARGPKWAIAYKFPAEEVESEVLNVEFQVGRTGAITPVARLKPVAVGG
VIVSNATLHNINEIKRKDIRVGDRVIVRRAGDVIPEVVKSLPQYRKSDAQMVEMPTNCPV
CDSKIENVNDQAIYRCTGGWHCQAQTTERLKHFVSRKAMDIDKLGAKLIEQLVAANLIKY
PADIYKLNFEQLTGLERMAAKSSQNVLDSITKSKEPSLARFIFAIGIKDIGEVSSDALAN
HFGSLESFRDAKFEELIEINDIGEIMANNIVSFWHDSLNIKIVEEFLAIGIKIQNPVKVE
HAYNESFTGKTVVITGSFENYGRTELTQLLKSIGAKVTSSVSKKTDMVICGDNAGSKLTK
AQELGVEVILEDNLKDLL
Download sequence
Identical sequences A0A0E2ZJN5 A0A0H3TQD6 A4IWW8 B2SFT1 Q14GL3 Q5NF60
gi|187931418|ref|YP_001891402.1| gi|56708436|ref|YP_170332.1| gi|379726271|ref|YP_005318457.1| gi|385795093|ref|YP_005831499.1| gi|379717667|ref|YP_005306003.1| gi|134301572|ref|YP_001121540.1| WP_003024021.1.101979 WP_003024021.1.10388 WP_003024021.1.11695 WP_003024021.1.17073 WP_003024021.1.17471 WP_003024021.1.1833 WP_003024021.1.19035 WP_003024021.1.2301 WP_003024021.1.25812 WP_003024021.1.26192 WP_003024021.1.26690 WP_003024021.1.31410 WP_003024021.1.35965 WP_003024021.1.3831 WP_003024021.1.38368 WP_003024021.1.38474 WP_003024021.1.38662 WP_003024021.1.39861 WP_003024021.1.40634 WP_003024021.1.42944 WP_003024021.1.44744 WP_003024021.1.47286 WP_003024021.1.52816 WP_003024021.1.53326 WP_003024021.1.5563 WP_003024021.1.56738 WP_003024021.1.5829 WP_003024021.1.59625 WP_003024021.1.60146 WP_003024021.1.61154 WP_003024021.1.65967 WP_003024021.1.66077 WP_003024021.1.66092 WP_003024021.1.66463 WP_003024021.1.67317 WP_003024021.1.75261 WP_003024021.1.77053 WP_003024021.1.78037 WP_003024021.1.80616 WP_003024021.1.82545 WP_003024021.1.87851 WP_003024021.1.95561 WP_003024021.1.98147 YP_170332.1.84429 gi|110670907|ref|YP_667464.1| 177416.FTT_1387c 393115.FTF1387c 418136.FTW_0501 441952.FTM_0637

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]