SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385795240|ref|YP_005831646.1| from Francisella tularensis subsp. tularensis NE061598

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385795240|ref|YP_005831646.1|
Domain Number 1 Region: 102-183
Classification Level Classification E-value
Superfamily Methylated DNA-protein cysteine methyltransferase, C-terminal domain 3.92e-29
Family Methylated DNA-protein cysteine methyltransferase, C-terminal domain 0.00015
Further Details:      
 
Domain Number 2 Region: 26-108
Classification Level Classification E-value
Superfamily Methylated DNA-protein cysteine methyltransferase domain 0.00000000000000844
Family Methylated DNA-protein cysteine methyltransferase domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|385795240|ref|YP_005831646.1|
Sequence length 190
Comment methylated-DNA--protein-cysteine methyltransferase [Francisella tularensis subsp. tularensis NE061598]
Sequence
MLKETHQIYLAAINKKSYKTVFYAQEIQTPIGNLIAVADDDYLYACFFISDSNIYSIEKL
LKIYNAKISFNADNITNQTKDQLNKYFKRELKSFSVPLRLTGTDFQKQVWRELIKIPYGE
TISYRKEATNIGKPTAFRAVANANGKNLLPIIIPCHRVINTNGKLGGYTGGLYKKEFLLN
LEHSILIHKN
Download sequence
Identical sequences A0A0E3A681 A0A0G2RNM2 Q5NEU2
177416.FTT_1518 393115.FTF1518 418136.FTW_0773 441952.FTM_0379 WP_003022399.1.101979 WP_003022399.1.10388 WP_003022399.1.11695 WP_003022399.1.17073 WP_003022399.1.17471 WP_003022399.1.1833 WP_003022399.1.19035 WP_003022399.1.2301 WP_003022399.1.25812 WP_003022399.1.26192 WP_003022399.1.31410 WP_003022399.1.35965 WP_003022399.1.36081 WP_003022399.1.3831 WP_003022399.1.38368 WP_003022399.1.38474 WP_003022399.1.38662 WP_003022399.1.39861 WP_003022399.1.40634 WP_003022399.1.42944 WP_003022399.1.44744 WP_003022399.1.52816 WP_003022399.1.53326 WP_003022399.1.5563 WP_003022399.1.56738 WP_003022399.1.5829 WP_003022399.1.59625 WP_003022399.1.60146 WP_003022399.1.61154 WP_003022399.1.65967 WP_003022399.1.66077 WP_003022399.1.66092 WP_003022399.1.66463 WP_003022399.1.67317 WP_003022399.1.75261 WP_003022399.1.77053 WP_003022399.1.78037 WP_003022399.1.80616 WP_003022399.1.82545 WP_003022399.1.87851 WP_003022399.1.95561 WP_003022399.1.98147 YP_170450.1.84429 gi|379717785|ref|YP_005306121.1| gi|187931212|ref|YP_001891196.1| gi|134301800|ref|YP_001121768.1| gi|110671025|ref|YP_667582.1| gi|379726388|ref|YP_005318574.1| gi|385795240|ref|YP_005831646.1| IDP02832 gi|56708554|ref|YP_170450.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]