SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385795256|ref|YP_005831662.1| from Francisella tularensis subsp. tularensis NE061598

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385795256|ref|YP_005831662.1|
Domain Number 1 Region: 143-470
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 1.72e-39
Family NadC C-terminal domain-like 0.037
Further Details:      
 
Domain Number 2 Region: 3-130
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase N-terminal domain-like 0.0000126
Family NadC N-terminal domain-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|385795256|ref|YP_005831662.1|
Sequence length 471
Comment putative nicotinate phosphoribosyltransferase [Francisella tularensis subsp. tularensis NE061598]
Sequence
MSFDNLLLMTDSYKHSHRYQYPRDTHYLHFYLESRGTANKDLGNYTKFFGLQYYVKKYLS
QPITQQMIDDAEKILLAHGLPFYRSGFEKILNNYNGYLPIRIRAVREGSLIPLHNVLMTI
ESTDEELFWLPGFVETLLLKVWYPTTVATISFNIKQLIKRYLLETADSLDKLDFMLHDFG
YRGVSSEESAGIGGAAHLTNFLGTDTLAALHVCKEFYAEDMAGFSIPASEHSTMTSWGVG
TECEREAFENMIAQFGDSSVLYACVSDSWDFKKAIQTWVDLKDRVTAKKANLVIRPDSGD
AVDNILYALYELDKGYGSRLNSKGYKVLNNVALIQGDSVSISLAKKVLEAMKIQGYSAEN
IAFGMGGALLQGNYESSINRDSFKFAIKCSAIMRGNTLIGVKKEPITDLAKKSKQGRLDL
IKDAKGNYKTIVLDDSYALGEYHPESQLQTYYDNGEIKFEQSLAQIRNYTN
Download sequence
Identical sequences A0A0E3A662 A0A0G2RNU2 Q5NES9
gi|187931201|ref|YP_001891185.1| gi|110671038|ref|YP_667595.1| gi|379726401|ref|YP_005318587.1| WP_003018116.1.101979 WP_003018116.1.10388 WP_003018116.1.11695 WP_003018116.1.17073 WP_003018116.1.17471 WP_003018116.1.1833 WP_003018116.1.19035 WP_003018116.1.2301 WP_003018116.1.25812 WP_003018116.1.26192 WP_003018116.1.26690 WP_003018116.1.31410 WP_003018116.1.35965 WP_003018116.1.36081 WP_003018116.1.37819 WP_003018116.1.3831 WP_003018116.1.38368 WP_003018116.1.38474 WP_003018116.1.38662 WP_003018116.1.39861 WP_003018116.1.40634 WP_003018116.1.42944 WP_003018116.1.44744 WP_003018116.1.45210 WP_003018116.1.4633 WP_003018116.1.47286 WP_003018116.1.50994 WP_003018116.1.52816 WP_003018116.1.53326 WP_003018116.1.5414 WP_003018116.1.5563 WP_003018116.1.56738 WP_003018116.1.5829 WP_003018116.1.59625 WP_003018116.1.60146 WP_003018116.1.61154 WP_003018116.1.65967 WP_003018116.1.66077 WP_003018116.1.66092 WP_003018116.1.66463 WP_003018116.1.67317 WP_003018116.1.75261 WP_003018116.1.77053 WP_003018116.1.78037 WP_003018116.1.80474 WP_003018116.1.80616 WP_003018116.1.82545 WP_003018116.1.87851 WP_003018116.1.95561 WP_003018116.1.98147 YP_170463.1.84429 gi|134301482|ref|YP_001121450.1| gi|385795256|ref|YP_005831662.1| gi|379717798|ref|YP_005306134.1| gi|56708567|ref|YP_170463.1| 177416.FTT_1534c 393115.FTF1534c 418136.FTW_0395 441952.FTM_0364

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]