SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385795364|ref|YP_005831770.1| from Francisella tularensis subsp. tularensis NE061598

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385795364|ref|YP_005831770.1|
Domain Number 1 Region: 101-204
Classification Level Classification E-value
Superfamily FinO-like 6.28e-25
Family FinO-like 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|385795364|ref|YP_005831770.1|
Sequence length 233
Comment putative activator of osmoprotectant transporter [Francisella tularensis subsp. tularensis NE061598]
Sequence
MSEGRNKLNDFLLLQSLLGGSSKIEEKTSRMKQARDRNISKNKSIPKPTVVKKVEERDTS
FIRIPQYGHRINNKIVDELQNPQLEDNQEILVTVDIEKERQKEEARLFKWLCHRFPKCFD
PINKKPLKIGISEEIEIIYQNENYAPVDKMVLRNVLRRYVGDTRYHKAVFELKQRFNLQG
QPVEDYAPEHVEYSKKRLDEIAEKAEFRAKGLSMKDYYEYKKQQQQEKVDTEE
Download sequence
Identical sequences A0A0E2ZQJ7 A0A0M1U5Q9
gi|379717883|ref|YP_005306219.1| WP_003022576.1.101979 WP_003022576.1.10388 WP_003022576.1.11695 WP_003022576.1.17073 WP_003022576.1.17471 WP_003022576.1.1833 WP_003022576.1.19035 WP_003022576.1.2301 WP_003022576.1.25812 WP_003022576.1.26192 WP_003022576.1.26690 WP_003022576.1.31410 WP_003022576.1.35965 WP_003022576.1.36081 WP_003022576.1.3831 WP_003022576.1.38368 WP_003022576.1.38474 WP_003022576.1.38662 WP_003022576.1.39861 WP_003022576.1.40634 WP_003022576.1.42944 WP_003022576.1.44744 WP_003022576.1.47286 WP_003022576.1.52816 WP_003022576.1.53326 WP_003022576.1.5563 WP_003022576.1.56738 WP_003022576.1.5829 WP_003022576.1.59625 WP_003022576.1.60146 WP_003022576.1.61154 WP_003022576.1.65967 WP_003022576.1.66077 WP_003022576.1.66092 WP_003022576.1.66463 WP_003022576.1.67317 WP_003022576.1.75261 WP_003022576.1.77053 WP_003022576.1.78037 WP_003022576.1.80616 WP_003022576.1.82545 WP_003022576.1.87851 WP_003022576.1.98147 YP_008492918.1.84429 418136.FTW_0273 gi|385795364|ref|YP_005831770.1| gi|379726486|ref|YP_005318672.1| gi|537470121|ref|YP_008492918.1| gi|134301384|ref|YP_001121352.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]