SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385795524|ref|YP_005831930.1| from Francisella tularensis subsp. tularensis NE061598

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385795524|ref|YP_005831930.1|
Domain Number 1 Region: 1-91
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 5.71e-27
Family Formate/glycerate dehydrogenases, NAD-domain 0.0000249
Further Details:      
 
Weak hits

Sequence:  gi|385795524|ref|YP_005831930.1|
Domain Number - Region: 93-131
Classification Level Classification E-value
Superfamily Formate/glycerate dehydrogenase catalytic domain-like 0.000187
Family Formate/glycerate dehydrogenases, substrate-binding domain 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|385795524|ref|YP_005831930.1|
Sequence length 139
Comment formate dehydrogenase, partial [Francisella tularensis subsp. tularensis NE061598]
Sequence
MLKVCDVITINCPLHKETENLFDEVRINKMKKGAYLINTARAKICDTQAIAKALETGQLS
GYAGDVWYPQPAPKDHIWRTMPYNGMTPHTSGTTLSAQARYAAGTREILECFFSGKEIRD
EYYIVKNGELAGVGAHSYK
Download sequence
Identical sequences A0A0E2ZK02 A0A0H3TPR7
gi|385795524|ref|YP_005831930.1| WP_003024313.1.101979 WP_003024313.1.10388 WP_003024313.1.11695 WP_003024313.1.1833 WP_003024313.1.19035 WP_003024313.1.2301 WP_003024313.1.25812 WP_003024313.1.31410 WP_003024313.1.35965 WP_003024313.1.36081 WP_003024313.1.3831 WP_003024313.1.38368 WP_003024313.1.38474 WP_003024313.1.38662 WP_003024313.1.40634 WP_003024313.1.44744 WP_003024313.1.52816 WP_003024313.1.56738 WP_003024313.1.5829 WP_003024313.1.59625 WP_003024313.1.60146 WP_003024313.1.61154 WP_003024313.1.65967 WP_003024313.1.66077 WP_003024313.1.66092 WP_003024313.1.67317 WP_003024313.1.75261 WP_003024313.1.77053 WP_003024313.1.80616 WP_003024313.1.82545 WP_003024313.1.87851 WP_003024313.1.98147

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]