SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385794298|ref|YP_005830704.1| from Francisella tularensis subsp. tularensis NE061598

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385794298|ref|YP_005830704.1|
Domain Number 1 Region: 8-156
Classification Level Classification E-value
Superfamily Lysozyme-like 2.16e-22
Family G-type lysozyme 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|385794298|ref|YP_005830704.1|
Sequence length 189
Comment hypothetical protein NE061598_03045 [Francisella tularensis subsp. tularensis NE061598]
Sequence
MLKKFGFRYFVVSLFCLLLLSCSETTKIDTNAGVCEILKQHPNCKKSLKQSQAKYNLEPA
FIMALIYQESRFYANAKNKYSSAYGYAQVIDSTWKHFQQQVKANAKRNNFDDSIEFIGWH
MTQLSKSLNIKMTDYPNLYMAYMLGATGFKRYRAGTLKNHAKIAQDKKIALKVKDYTNLY
KSQLRKCPL
Download sequence
Identical sequences A0A0E3A4W0 A0A0G2RQ60 Q5NHC5
177416.FTT_0538c 393115.FTF0538c gi|110670142|ref|YP_666699.1| gi|56707671|ref|YP_169567.1| gi|379725529|ref|YP_005317715.1| gi|379716925|ref|YP_005305261.1| WP_003023240.1.101979 WP_003023240.1.10388 WP_003023240.1.11695 WP_003023240.1.1833 WP_003023240.1.19035 WP_003023240.1.2301 WP_003023240.1.25812 WP_003023240.1.31410 WP_003023240.1.35965 WP_003023240.1.36081 WP_003023240.1.3831 WP_003023240.1.38368 WP_003023240.1.38474 WP_003023240.1.38662 WP_003023240.1.40634 WP_003023240.1.44744 WP_003023240.1.52816 WP_003023240.1.56738 WP_003023240.1.5829 WP_003023240.1.59625 WP_003023240.1.60146 WP_003023240.1.61154 WP_003023240.1.65967 WP_003023240.1.66077 WP_003023240.1.66092 WP_003023240.1.67317 WP_003023240.1.75261 WP_003023240.1.77053 WP_003023240.1.80616 WP_003023240.1.82545 WP_003023240.1.87851 WP_003023240.1.98147 YP_169567.1.84429 gi|385794298|ref|YP_005830704.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]