SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385794475|ref|YP_005830881.1| from Francisella tularensis subsp. tularensis NE061598

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385794475|ref|YP_005830881.1|
Domain Number 1 Region: 155-430,525-556
Classification Level Classification E-value
Superfamily (Trans)glycosidases 9.54e-64
Family Type II chitinase 0.0000553
Further Details:      
 
Domain Number 2 Region: 717-759
Classification Level Classification E-value
Superfamily Carbohydrate binding domain 0.0000000000000876
Family Carbohydrate binding domain 0.0036
Further Details:      
 
Domain Number 3 Region: 668-713
Classification Level Classification E-value
Superfamily Carbohydrate binding domain 0.000000000000732
Family Carbohydrate binding domain 0.0062
Further Details:      
 
Domain Number 4 Region: 574-641
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000534
Family Fibronectin type III 0.0019
Further Details:      
 
Domain Number 5 Region: 430-525
Classification Level Classification E-value
Superfamily Chitinase insertion domain 0.000000946
Family Chitinase insertion domain 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|385794475|ref|YP_005830881.1|
Sequence length 760
Comment chitinase family 18 protein [Francisella tularensis subsp. tularensis NE061598]
Sequence
MNKTKLVSVVCALMGLGSYSLLEAAPVNDVKTYDFKAPFKDYNNKIVLSINNVPSAKVVE
FTSNFKPKTGWGSCFGTRADLVNFETTQLSNGEYLTKLSLKDSEGSLDLTQTCDIMGTDS
GNALVLPGVVVPIVSSVKVDGKDLEIERPCADNVCEDPTPGYTNAAYYAQWAVWGRKYNP
YDFKYDKLNTIIYAFIGFDKNTGNIKTLDASADSWGLSAAARAAKKYPYLKSFLSFGGWT
NNGVTTAPMFEQLASNQQSMENFAKQSVELMRKLGFNGIDIDWEWWSDYGDDVAPAKKML
AFFKVLRAELDKASKADGKKYYLAIAVNGARSRIEAMENPNNPNSVADFWKQIGELMDEI
NIMNYDYQGGWGTGAPAWFQASAAFPNINFSPEVANSIGKTGGWSVQGSVDAYIKAGVPA
KKLIVGLPLYARSMTVASDTDGGLLQTITAPGFGDYEAGVFDYKCLINPVNDPVNGCGTA
KPISGLSDLVYYDISSNVDIFNKYGKVAMQPWAYSPSTKTFVTFDDVWSVSEKTKYAKSK
NLGGTMFWQADGDSTDTNKSLINAVAKVYASDTINVSVSDVTENSASISWNKPELDGSIK
YRVLLNGKTIAENITSQSYVLTNLDKGTRYTIEVIASTSNASREDSITFETIGADDQNND
QNNDQNNNAGSTGNWNAEAVYNKGDKVIVNGVTYEAQWWTQGNNPADGGAWKKPFVSGEA
WSQGQAYTGGQVVTYQGAKYKAKWWTQGDIPSNSNVWEKQ
Download sequence
Identical sequences A0A0E3A2S0 A0A0G2RND5 Q5NGW2
gi|56707834|ref|YP_169730.1| gi|379717082|ref|YP_005305418.1| gi|379725686|ref|YP_005317872.1| WP_003020524.1.101979 WP_003020524.1.10388 WP_003020524.1.11695 WP_003020524.1.1833 WP_003020524.1.19035 WP_003020524.1.2301 WP_003020524.1.25812 WP_003020524.1.31410 WP_003020524.1.35965 WP_003020524.1.36081 WP_003020524.1.3831 WP_003020524.1.38368 WP_003020524.1.38474 WP_003020524.1.38662 WP_003020524.1.40634 WP_003020524.1.44744 WP_003020524.1.52816 WP_003020524.1.56738 WP_003020524.1.5829 WP_003020524.1.59625 WP_003020524.1.60146 WP_003020524.1.61154 WP_003020524.1.65967 WP_003020524.1.66077 WP_003020524.1.66092 WP_003020524.1.67317 WP_003020524.1.75261 WP_003020524.1.77053 WP_003020524.1.80616 WP_003020524.1.82545 WP_003020524.1.87851 WP_003020524.1.98147 YP_169730.1.84429 gi|110670305|ref|YP_666862.1| 177416.FTT_0715 393115.FTF0715 gi|385794475|ref|YP_005830881.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]