SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385794793|ref|YP_005831199.1| from Francisella tularensis subsp. tularensis NE061598

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385794793|ref|YP_005831199.1|
Domain Number 1 Region: 8-184
Classification Level Classification E-value
Superfamily Lysozyme-like 7.03e-24
Family Bacterial muramidase, catalytic domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|385794793|ref|YP_005831199.1|
Sequence length 203
Comment hypothetical protein NE061598_05965 [Francisella tularensis subsp. tularensis NE061598]
Sequence
MKKIIKLATLIIIITTLGSCATEPPTNINNACSIIHQFPDWYYDMLDSYDRWGIPINVQM
AFIRQESSFRADAKPSMQYYFGFIPKGRASSAYGFAQALDGTWDHYKKQTKQSFVSRSNF
ADATDFIGWYLNDIHNKTGISKTDTYNLYLAYHEGIGGYKRGTHRNNSFLKNYARKTTEI
AQKYSIQLQNCEVPRKPLLSYIF
Download sequence
Identical sequences A0A0B3WH79 A0A0E2ZHY6 A0A0G2RMR8 Q5NG19
gi|422938775|ref|YP_007011922.1| gi|56708127|ref|YP_170023.1| gi|115314829|ref|YP_763552.1| gi|89256383|ref|YP_513745.1| gi|134301938|ref|YP_001121907.1| gi|110670598|ref|YP_667155.1| gi|385794793|ref|YP_005831199.1| gi|156502472|ref|YP_001428537.1| gi|423050736|ref|YP_007009170.1| WP_003015611.1.100020 WP_003015611.1.100480 WP_003015611.1.100639 WP_003015611.1.101979 WP_003015611.1.10388 WP_003015611.1.11004 WP_003015611.1.11695 WP_003015611.1.12700 WP_003015611.1.12820 WP_003015611.1.13116 WP_003015611.1.1316 WP_003015611.1.13715 WP_003015611.1.13896 WP_003015611.1.1431 WP_003015611.1.15828 WP_003015611.1.17073 WP_003015611.1.17117 WP_003015611.1.17471 WP_003015611.1.18135 WP_003015611.1.1833 WP_003015611.1.19035 WP_003015611.1.19348 WP_003015611.1.21553 WP_003015611.1.2186 WP_003015611.1.2301 WP_003015611.1.24109 WP_003015611.1.24307 WP_003015611.1.2436 WP_003015611.1.25474 WP_003015611.1.25812 WP_003015611.1.26192 WP_003015611.1.26690 WP_003015611.1.27183 WP_003015611.1.27408 WP_003015611.1.28031 WP_003015611.1.28288 WP_003015611.1.30377 WP_003015611.1.31247 WP_003015611.1.3134 WP_003015611.1.31410 WP_003015611.1.31907 WP_003015611.1.33374 WP_003015611.1.34036 WP_003015611.1.35898 WP_003015611.1.35965 WP_003015611.1.36081 WP_003015611.1.36125 WP_003015611.1.36481 WP_003015611.1.37362 WP_003015611.1.37819 WP_003015611.1.38195 WP_003015611.1.3831 WP_003015611.1.38368 WP_003015611.1.38474 WP_003015611.1.38662 WP_003015611.1.38763 WP_003015611.1.3975 WP_003015611.1.39861 WP_003015611.1.40634 WP_003015611.1.40692 WP_003015611.1.41167 WP_003015611.1.42944 WP_003015611.1.43575 WP_003015611.1.43882 WP_003015611.1.44313 WP_003015611.1.44744 WP_003015611.1.44922 WP_003015611.1.45908 WP_003015611.1.4633 WP_003015611.1.46791 WP_003015611.1.46956 WP_003015611.1.47286 WP_003015611.1.47340 WP_003015611.1.48020 WP_003015611.1.48098 WP_003015611.1.48962 WP_003015611.1.50994 WP_003015611.1.51529 WP_003015611.1.52816 WP_003015611.1.53326 WP_003015611.1.5414 WP_003015611.1.54420 WP_003015611.1.5487 WP_003015611.1.54961 WP_003015611.1.55289 WP_003015611.1.5563 WP_003015611.1.56738 WP_003015611.1.57478 WP_003015611.1.5829 WP_003015611.1.59625 WP_003015611.1.59871 WP_003015611.1.5992 WP_003015611.1.60112 WP_003015611.1.60146 WP_003015611.1.60504 WP_003015611.1.61154 WP_003015611.1.63091 WP_003015611.1.63562 WP_003015611.1.64987 WP_003015611.1.65566 WP_003015611.1.65967 WP_003015611.1.66077 WP_003015611.1.66092 WP_003015611.1.66463 WP_003015611.1.67317 WP_003015611.1.6752 WP_003015611.1.68327 WP_003015611.1.69118 WP_003015611.1.69545 WP_003015611.1.69933 WP_003015611.1.7106 WP_003015611.1.72408 WP_003015611.1.72665 WP_003015611.1.73228 WP_003015611.1.73973 WP_003015611.1.74506 WP_003015611.1.74697 WP_003015611.1.75261 WP_003015611.1.77053 WP_003015611.1.77714 WP_003015611.1.77892 WP_003015611.1.78037 WP_003015611.1.78521 WP_003015611.1.80474 WP_003015611.1.80603 WP_003015611.1.80616 WP_003015611.1.82216 WP_003015611.1.8254 WP_003015611.1.82545 WP_003015611.1.83968 WP_003015611.1.84288 WP_003015611.1.84370 WP_003015611.1.85044 WP_003015611.1.85695 WP_003015611.1.85899 WP_003015611.1.87224 WP_003015611.1.87451 WP_003015611.1.87851 WP_003015611.1.88243 WP_003015611.1.90324 WP_003015611.1.93025 WP_003015611.1.93182 WP_003015611.1.95205 WP_003015611.1.95453 WP_003015611.1.95669 WP_003015611.1.9679 WP_003015611.1.96937 WP_003015611.1.97486 WP_003015611.1.98147 WP_003015611.1.99661 YP_170023.1.84429 119857.FTL_1045 177416.FTT_1040 393011.FTH_1024 393115.FTF1040 418136.FTW_0949 458234.FTA_1105

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]