SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000000097 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000000097
Domain Number 1 Region: 296-510
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.26e-52
Family DBL homology domain (DH-domain) 0.00016
Further Details:      
 
Domain Number 2 Region: 814-1081
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00000000000000117
Family WD40-repeat 0.0078
Further Details:      
 
Domain Number 3 Region: 523-606,701-759
Classification Level Classification E-value
Superfamily PH domain-like 0.000000112
Family Pleckstrin-homology domain (PH domain) 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000000097   Gene: ENSMGAG00000000716   Transcript: ENSMGAT00000000728
Sequence length 1255
Comment pep:known_by_projection chromosome:UMD2:23:111591:127528:-1 gene:ENSMGAG00000000716 transcript:ENSMGAT00000000728 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSQLPPCPTVGTVLASQPPSELPPGEEDLGEAFDFEDSDEEEDEDSATEPSRLPPSSG
CPSLVLCLSFPISFPVAAEFAPWVRLPEQVSNGEACEDPPDINTQTWKRKSGHQGDRFEF
TAAEDDVIYDDVPCENLDANQDGRRRSLIYEDVQRGEELGWSSSEFESYSEESGEENKPE
AEPAKHRASFQPKLSPDLNRLKETYARTKRDILALRVGGKDMQELKQKYDWKMTQLMKAA
KSGTKDGLEKTKIAVMRKVTFLHRKEVPGDSEEEDTGFLEVTVSDAKHPPPELGPMPTGL
SPQQVVRRHILGSIVQSERSYVESLKRILQDYRNPLMEMEPKVLSARKCQVVFFRLKEIL
QCHSMFQIALSSRVAEWDSAEKIGDLFVASFSKSMVLDVYSDYVNNFTTAMSLIKKACLT
KPAFLDFLKKRQMASTDRVTLYGLMVKPIQRFPQFILLLQDMLKNTPKGHADRLSLQLAL
TELETLAEKLNEQKRVADQVAEIQQLSKSISDRSSLSKLLNSGQRQLLLCETLTETVYGD
RGQLIKSKERKVFLLNDMLVCANINFKPVNPRGQLEISSLVPLGPKYVVKWSTALPQVQV
VEVGQESGAYDKDNVVIHNAGAKKHAPTGPASHNKVYLGPPRLFQELQDLQKDLAVVEQI
TLLISTLHGTYQNLNMTVAQDWCLALQRMMKVKEEEIHSANKCRLRLLLPGKPDKSGRPI
SVMVVFITPNPLSKISWVNCLHLAKIGLREENQPGWLCPDEDKKSKAPFWCPILSCHMPA
FSSKALDLQLSAAVHNPVQSSLLGFSAVSTSLPQGYLWVGGGQEGAGGQVEIFSLNRSVP
RTVKSFPVASPVLCMEYIPEAAEGDTEGTEEPRAGAEQPPATLHPTVCLGLRDGSIAVYS
SVDTGTQCLLTCKSPGTQPVLCLKHSPEYLFAGLQDGTVAAYPRNNVGLWDLTEQPTRLP
VGTSPVRALLMLDETLWASCANQVTVLDASTLCAQQTFEAHPDTEASVTHMIKAGSGVWM
AFSSGSSIRLFHTETLEHLQEINIATRTTFVLPGQRHVRVTSLLICQGLLWVGTDQGIIV
LLPVPRLEGIPKITGKGMVSLNGHGGPVDFLAVALSTLAPDVLKGDQEDEDGEEEKPLEL
DGPPPREIRKKGILLQYRLRSTSHLPGQLLSVRDAPVGTVTPEHTEEDGSIYEMADDPDV
WVRSRPCARDAPRKEISSVAIISGGRGYRNFNSEPQRRGGDADSTLLIWQLPLML
Download sequence
Identical sequences G1MPX7
ENSMGAP00000000097 ENSMGAP00000000097

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]