SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000000699 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000000699
Domain Number 1 Region: 646-792
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 3.66e-47
Family Toll/Interleukin receptor TIR domain 0.000000198
Further Details:      
 
Domain Number 2 Region: 36-176,413-555
Classification Level Classification E-value
Superfamily L domain-like 9.35e-38
Family Ngr ectodomain-like 0.012
Further Details:      
 
Domain Number 3 Region: 326-434
Classification Level Classification E-value
Superfamily L domain-like 0.0000000799
Family Ngr ectodomain-like 0.086
Further Details:      
 
Domain Number 4 Region: 155-237
Classification Level Classification E-value
Superfamily L domain-like 0.00000218
Family Internalin LRR domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000000699   Gene: ENSMGAG00000001271   Transcript: ENSMGAT00000001344
Sequence length 793
Comment pep:known chromosome:UMD2:4:295903:302407:1 gene:ENSMGAG00000001271 transcript:ENSMGAT00000001344 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFNQSKQKPTTKLMWQVWMIYIALAAHLPEEQALRQACLSCDATQSCNCSSMGLDFIPSG
LTGKITALNLAHNRIKLIRAHDLQQAVNLRALLLQSNQISSIDEDSFASQGKLELLDLSN
NSLARLSPAWFGPLFSLQHLRIQGNSYSDLGESSPFSSLRNLNSLHLGNPQFSVIRQGNF
EGITFLSTLKIDGGNLSQYEPGSLKSIRKINHMIISVRRIDVFSAVIRDLLHSAIWLEVR
EIKLDIENEKLIQNSTLPSTIEKLTFTGASFTDQYISRIAVLLKEITSLRELEAIDCVLD
GKGEWDTTEIARSRQSSVETISVTNMTILDFYLFFDLEGIETQVDKLKRLSIASSKVFMV
PCRLARYFSSLLYLDFHDNLLVNNRLAETICKGAWPSLQTLNLSKNSLKSLEQAAKYISN
LHKLINLDISENNFGEIPDVCGWPENLKYLNLSSTQIPKLTRCIPSTLEVLDVSANNLQD
FGLELPLLKELYLTKNHLKTLPEAAAIPNLVAMSISRNNLNSFSKKEFASFKQMELLDAS
ANNFICSCEFLSFIQHEAGITQVLVGWPESYICDSPLAVRGAQVGSVSLSLMECHRSFLV
SLICILMFLFILVLVVIGYKYHAVWYMRMTWAWLQAKRKPKRAPTKDICYDAFVSYSEND
SNWVENIMVQQLEQACPPFRLCLHKRDFVPGKWIVDNIIDSIEKSHKTLFVLSEHFVQSE
WCKYELDFSHFRLFDENNDAAILILLEPIQSQAIPKRFCKLRKIMNTKTYLEWPPDEEQQ
QMFWENLKAALKS
Download sequence
Identical sequences G1MRA8
ENSMGAP00000000699 ENSMGAP00000000699

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]