SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000001245 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000001245
Domain Number 1 Region: 15-152
Classification Level Classification E-value
Superfamily L domain-like 1.09e-26
Family U2A'-like 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000001245   Gene: ENSMGAG00000001727   Transcript: ENSMGAT00000001897
Sequence length 274
Comment pep:known_by_projection chromosome:UMD2:30:1177208:1181917:1 gene:ENSMGAG00000001727 transcript:ENSMGAT00000001897 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VGGRGVISLYIKNRFPSEVKELVLDNCRSDDGKIVGLSSDFENLEFLSMINVNLLSISNL
PKLNKLRKLELSDNRISGGLEVLAERTPNLTHLNLSGNKIKDINTLEPLKKLPNLHSLDL
FNCEVTMLINYRESVFTLLPQLTYLDGFDADEQEAPDSDPEADGDGLEDEYENGEEGEEE
EDDDEEDDLDEEVIDEEDDEDDDLEGEEEEDGVDDEEEDEEEDGEDEEDDEADDDLPRGE
KRKRNLEDEGEEDPEDEEDDEDXXXQRANQFYRL
Download sequence
Identical sequences G1MSF8
ENSMGAP00000001245 ENSMGAP00000001245

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]