SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000001247 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000001247
Domain Number 1 Region: 116-416
Classification Level Classification E-value
Superfamily L domain-like 5.58e-56
Family Ngr ectodomain-like 0.0072
Further Details:      
 
Domain Number 2 Region: 7-171
Classification Level Classification E-value
Superfamily L domain-like 2.89e-41
Family Internalin LRR domain 0.061
Further Details:      
 
Domain Number 3 Region: 479-769
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 5.22e-34
Family Rhodopsin-like 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000001247   Gene: ENSMGAG00000001702   Transcript: ENSMGAT00000001899
Sequence length 901
Comment pep:known_by_projection chromosome:UMD2:5:2727151:2762714:1 gene:ENSMGAG00000001702 transcript:ENSMGAT00000001899 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LCFFFHRDVSMNNITRLPEDAFKNFPYLEELRLAGNDLSFIHPKALSGLKELKVLTLQNN
QLKTVPNEAIRGLSGLQSLRLDANHITAVPKDSFEGLVQLRHLWLDDNSLTEVPIHPLSN
LPSLQALTLALNKITHIPDYAFTNLSSLVVLHLHNNKIKTIGKHCFDGLDNLETLDLNYN
NMVEFPEAIKALPNLKELAFHSNYISIIPDGAFAGNPLLRTIHLYDNPLSFVGNSAFQNL
SDLHSLVIRGASMVQWFPNLTGTVNLESLTLTGTKINSIPVNLCQEQKMLRTLDLSYNNI
KDLPSFTGCHSLEEISLQHNQIHEITDDTFQGLSSLRVLDLSRNRIRKIHKEAFTTIGAI
VNLDLSFNELTSVPTEGLSGLNQLKLAGNPELKEALAAKNFAKLRSLSVPYAYQCCAFWG
CDSYLNSNAEDSGRQDQDATGDREKVYLDTADADGLRNEENAELGQTIIHCTPATGAFKP
CEYLLGSWMIRLTVWFIFLVALFFNLLVMLTIFASCAPLPSSKLFIGLISISNLFMGVYT
GILTFLDAVSWGRFSEFGIWWETGSGCRVTGFLAVFSSESAIFFLMLAAVERSFSAKEII
KKGKSNHQKQFQIAAVLAFLCAVVAGCLPLFHKAKYSASPLCLPFPTGETPSLGFTVTLV
LLNSLAFLLMAVIYTKLYCNLEKEDLSENSQSSMIKHVAWLIFTNCIFFCPVAFFSFAPL
ITAISISPEIMKSVTLIFFPLPACLNPVLYVFFNPKFKEDWKLLRRQVSRKNGAVAISVS
AQGGCATQDFYYDCGMYTHLQGGSIAVCECCESLLLSKPVPCKHLIKSHSCPTLAVVSCQ
RPDGYWSDCGTQSAHSDYADEDDSFVSDSSDQVQACGRACFYQSRGFPLVRYAYNIPRIK
D
Download sequence
Identical sequences G1MSG0
ENSMGAP00000001247 ENSMGAP00000001247

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]