SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000001656 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000001656
Domain Number 1 Region: 26-124
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.52e-30
Family Ribosomal protein S14 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000001656   Gene: ENSMGAG00000002127   Transcript: ENSMGAT00000002320
Sequence length 124
Comment pep:known_by_projection chromosome:UMD2:10:3598552:3602554:-1 gene:ENSMGAG00000002127 transcript:ENSMGAT00000002320 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASALCWALRAARQVLPSQTRGYYVDWRMLRDVKRRKLAYEYADERLRINAIRKNTILP
KELQEVADKEIAALPRDSCPVRIHNRCVLTSRPRGVKRRWRLSRIVFRHFADHAQMSGIQ
RAMW
Download sequence
Identical sequences G1MTD2
XP_003208583.1.16129 ENSMGAP00000001656 ENSMGAP00000001656

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]