SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000001801 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000001801
Domain Number 1 Region: 5-76
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.17e-17
Family Calponin-homology domain, CH-domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000001801   Gene: ENSMGAG00000002246   Transcript: ENSMGAT00000002470
Sequence length 820
Comment pep:novel chromosome:UMD2:5:4466783:4557416:-1 gene:ENSMGAG00000002246 transcript:ENSMGAT00000002470 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FPANEKIEDINGCPKNRSQMIENIDACLSFLAAKGINIQGLSAEEIRNGNLKAILGLFFS
LSRYKQQQQQPQKQPPQHHLSQPTPSVSLQAGLPSQGQAGPQQQQQVPASLQTQCQQPQQ
AVQHPFKAQPEMQSSASPRDSSQSKIIRFTLGQKKSSRLPGPTTRVSTAGSETKTRGSIS
TNNRRSQSFNNYDKSKPGVLLPAPTSCNEKEPADSTAFQPTGMNENVSSSVQSCSGTTSC
NNSSAIPQPSSAIKPWRSKSLSAKHTATSSMLSVKQPVPEPPKPPSEVVKTTPNGQKSML
EKLKLFNSKGGSKAGGTTLECSTSRDSSCEKLETLPSFEESEEIDATNQNVSNPGSMSSS
PKIALKGIAQRTFSRALTNKKSSPKGNEKEKEKQKEKEKDKSKDTGKRTSITEKLDVKEE
PKEEQTVLTTTEMPKKSSKIASFIPKGGKLNSAKKEASAPLHSGIPKPGMKNTAGKSSSA
PVSTKESERSRSGKPGSGLSHQKSQLDSRNSSSSSSLASSEGKGIGGLNSSNSSQSVSGP
TTTHSTGSNTVSVQLPQPQQQYSHPNTATVAPFMYRSQTENEGNVTAEASTGGVSMDSTL
YVKTGQPGLEDLSGEDPETRRLRTVKNIADLRQNLEETMSSLRGTQVTHSTLETTFDTNV
TTEISGRSILSLTGRPTPLSWRLGQSSPRLQAGDAPSMGNGYPPRGNASRFINTESGRYM
YSAPLRRQLASRGSSVCHVDISDKGSDEIDLEGITMDATGYMSDGDVLGKNIRTDDITSG
YMTDGGLGLYTRRLNRLPDGMAAVRETMQRNTSLGLGDAD
Download sequence
Identical sequences G1MTP7
ENSMGAP00000001801 ENSMGAP00000001801

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]