SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000002060 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000002060
Domain Number 1 Region: 14-279
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 8.35e-92
Family Calponin-homology domain, CH-domain 0.000000733
Further Details:      
 
Domain Number 2 Region: 2191-2307
Classification Level Classification E-value
Superfamily PH domain-like 1.18e-37
Family Pleckstrin-homology domain (PH domain) 0.00000295
Further Details:      
 
Domain Number 3 Region: 295-416
Classification Level Classification E-value
Superfamily Spectrin repeat 7.59e-36
Family Spectrin repeat 0.0000528
Further Details:      
 
Domain Number 4 Region: 603-742
Classification Level Classification E-value
Superfamily Spectrin repeat 8.28e-33
Family Spectrin repeat 0.00017
Further Details:      
 
Domain Number 5 Region: 1645-1799
Classification Level Classification E-value
Superfamily Spectrin repeat 1.07e-29
Family Spectrin repeat 0.0025
Further Details:      
 
Domain Number 6 Region: 1538-1694
Classification Level Classification E-value
Superfamily Spectrin repeat 1.11e-29
Family Spectrin repeat 0.001
Further Details:      
 
Domain Number 7 Region: 1222-1375
Classification Level Classification E-value
Superfamily Spectrin repeat 4.03e-28
Family Spectrin repeat 0.00049
Further Details:      
 
Domain Number 8 Region: 1857-2011
Classification Level Classification E-value
Superfamily Spectrin repeat 2.29e-27
Family Spectrin repeat 0.0021
Further Details:      
 
Domain Number 9 Region: 812-951
Classification Level Classification E-value
Superfamily Spectrin repeat 1.08e-26
Family Spectrin repeat 0.0015
Further Details:      
 
Domain Number 10 Region: 425-528
Classification Level Classification E-value
Superfamily Spectrin repeat 2.62e-23
Family Spectrin repeat 0.00032
Further Details:      
 
Domain Number 11 Region: 529-637
Classification Level Classification E-value
Superfamily Spectrin repeat 3.8e-22
Family Spectrin repeat 0.00036
Further Details:      
 
Domain Number 12 Region: 1012-1165
Classification Level Classification E-value
Superfamily Spectrin repeat 5.76e-22
Family Spectrin repeat 0.0000503
Further Details:      
 
Domain Number 13 Region: 746-846
Classification Level Classification E-value
Superfamily Spectrin repeat 1.77e-20
Family Spectrin repeat 0.00039
Further Details:      
 
Domain Number 14 Region: 1383-1481
Classification Level Classification E-value
Superfamily Spectrin repeat 6.81e-18
Family Spectrin repeat 0.0004
Further Details:      
 
Domain Number 15 Region: 2016-2077
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000331
Family Spectrin repeat 0.0018
Further Details:      
 
Weak hits

Sequence:  ENSMGAP00000002060
Domain Number - Region: 961-1023
Classification Level Classification E-value
Superfamily SNARE fusion complex 0.00837
Family SNARE fusion complex 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000002060   Gene: ENSMGAG00000002389   Transcript: ENSMGAT00000002733
Sequence length 2361
Comment pep:known_by_projection chromosome:UMD2:2:2695756:2785798:-1 gene:ENSMGAG00000002389 transcript:ENSMGAT00000002733 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTTVATDYDNIEIQQQYSDVNNRWDVDDWDNENSSARLFERSRIKALADEREAVQKKTF
TKWVNSHLARVSCRITDLYTDLRDGRMLIKLLEVLSGERLPKPTKGRMRIHCLENVDKAL
QFLKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDALL
LWCQMKTAGYPNVNIHNFTTSWRDGMAFNALIHKHRPDLIDFDKLKKSNAHYNLQNAFNL
AEQHLGLTKLLDPEDISVDHPDEKSIITYVVTYYHYFSKMKALAVEGKRIGKVLDNAIET
EKMIEKYESLASDLLEWIEQTIIILNNRKFANSLVGVQQQLQAFNTYRTVEKPPKFTEKG
NLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRNELIRQEKL
EQLARRFDRKAAMRETWLSENQRLVSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVQA
VVAVAKELETENYHDIKRITARKDNVIRLWEYLLELLRARRQRLEMNLGLQKIFQEMLYI
MDWMDEMKVLLLSQDYGKHLLGVEDLLQKHALVEADIAIQAERVRGVNASAQKFATDGEG
YKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEQI
LSSDDYGKDLTSVVRLLSKHKAFEDEMSGRSGHFQQAIKEGEDMIAEEHFGSEKIKERIK
DIREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSNDVGHDEYSTQ
SLVKKHKDVAEEIASYRPTIDSLHEQAKALPQEHAGSPDVQGRLSGIEERYKEVAELTRL
RKQALQDTLALYKMFSEADACELWIDEKEKWLNNMQIPEKLEDLEVIQHRFESLEPEMNN
QASRVAVVNQIARQLMHSGHPSEKEIKAQQDKLNTRWSQFRELVDRKKDALISALSIQNY
HLECNETKSWIREKTKVIESTQDLGNDLAGVMALQRKKLTGMERDLVAIEAKLSDLQKEA
EKLESEHPDQAQAILSSRLAEINDVWEEMKTTLKNREESLGEASKLQQFLRDLGLRLSRT
QTAIASEDMPNTLTEAEKLLTQHENIKNEINNYEEDYQKMRDMGEMVTQGQTDAQYMFLR
QRLQALDTGWNELHKMWENRQNLLSQSHAYQLFLRDTKQAEAFLNNQEYVLAHTEMPTTL
EGAEAAIKKQEDFMTTMDANEEKINAVVETGRRLVSDGNINSDKIQEKVDSIDDRHRKNR
EAASELLMRLKDNRDLQKFLQDCQELSLWINEKMLTAQDMSYDEARNLHSKWLKHQAFMA
ELASNKEWLEKIEKEGMQLIAEKPETEAVVKEKLTGLHQMWEELESTTQTKAQRLFDANK
AELFTQSCADLDKWLNGLESQIQSDDYGKDLTSVNILLKKQQMLENQMDVRKKEIEELQS
QARALSQEGKSTDEVDGKRLTVEKKFLELLEPLNERKANLLASKEIHQFNRDVEDEILWV
GERMPIATSTDHGHNLQTVQLLIKKNQTLQKEIQGHQPRIDDIFERSQNIITDSSPNAEA
IQQRLADLKQLWNLLIEETEKRHKRLEESHRAQQYYFDAAEAEAWMSEQELYMMSEEKAK
DEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRTLVADNHPESERISMRQSKVDKLYAG
LKDLAEERRGKLDERHRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFRE
FARDTGNIGQERVDTVNHMADELINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILA
ASYELHKFYHDAKEILGRIQDKHKKLPEELGRDQNTVETLQRMHTTFEHDIQALGTQVRQ
LQEDAARLQAAYAGDKADDIQKRENEVLEAWKALLDACEGRRVRLVDTGDKFRFFSMVRD
LMLWMEDVIRQIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTTCIELGKSLLARKH
YASEEIKEKLLQLTEKRKEMIDKWEDRWEWLRLILEVHQFSRDASVAEAWLLGQEPYLSS
REIGQSVDEVEKLIKRHEAFEKSAATWDERFAALERLTTLELLEVRRQQEEEERKRKPPT
PEPSPKVAEDGGSQQQWDGTKGEQVSQNGLPSDQESPRVAETAETNEMVNGAADQRTSSK
ESSPVPSPTADRKATAAIQAQTAATLPAKTQEIPSAQMEGFLHRKHEWETHSKKASSRSW
HNVYCVINNQEMGFYKDSKAAASGIPYHNEIPVSLKEAVCEIAVDYKKKKHVFKLRLTDG
NEYLFQAKDDEEMNTWIQAITSAISSDKIEVSPTTQSTPASSRAQTLPASVTITSESSPG
KREKDKEKDKEKRFSLFGKKK
Download sequence
Identical sequences G1MU81
ENSMGAP00000002060 ENSMGAP00000002060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]