SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000003273 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000003273
Domain Number 1 Region: 29-229
Classification Level Classification E-value
Superfamily L domain-like 3.89e-33
Family Ngr ectodomain-like 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000003273   Gene: ENSMGAG00000003570   Transcript: ENSMGAT00000003972
Sequence length 294
Comment pep:known_by_projection chromosome:UMD2:10:5380593:5382616:-1 gene:ENSMGAG00000003570 transcript:ENSMGAT00000003972 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RRAMSPAGRWRPLSLVFLLGMGMASGDSGCPSGCSCRYLEVNCTGRQLQEFPAAIPLDTR
QLILAANNVSYLPAVELSFLADLVYLDCQKNLLGDDLDFTFIGVVKLVYLDLSFNNLTQV
TFSTFSQLLSLVVLKISDNPNLVAIEKDAFANNTWLRHLDVSRTGLTFLDASTVQVLPNL
RILGLSDNLWHCNCSFLDFITWMTESSVHFPADADNITCYTPEALRALKMPAAEVQLYSS
CQTHLHKHDYIFLCFIGFCIFFAGTVVAWLAGICAVIYQIHSSKEEEEEEEKDA
Download sequence
Identical sequences G1MWW1
ENSMGAP00000003273 ENSMGAP00000003273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]