SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000003334 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000003334
Domain Number 1 Region: 119-262
Classification Level Classification E-value
Superfamily L domain-like 5.44e-34
Family U2A'-like 0.024
Further Details:      
 
Weak hits

Sequence:  ENSMGAP00000003334
Domain Number - Region: 262-312
Classification Level Classification E-value
Superfamily Small-conductance potassium channel 0.0942
Family Small-conductance potassium channel 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000003334   Gene: ENSMGAG00000003618   Transcript: ENSMGAT00000004034
Sequence length 457
Comment pep:novel chromosome:UMD2:8:8820565:8827271:1 gene:ENSMGAG00000003618 transcript:ENSMGAT00000004034 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKSYIKKELCGKSQMSAFRIPTPMSSVGSGTRSSSPLSQQTSPPARRSRAWQNQQLDTT
ANVEAAFESKFYEGKNENGVSPGVRYITEPLIKSLSKQENLAYISSLNLSSPKDGDKKFK
YIENLERCSKLERLNLSNNQIEKIEKLDKLLKLRELNLSYNKISKIEGMEHLYNLQKMNL
AGNEIEHIPVWVGKKLRSLRILNLKQNKVSSLHEVAKLKPLQDLTSLFLAGNPVASLPHY
RLYVIFHLRALENLDGQPVTNHDRQEALKRFDLEEIEKLERELENAIKEMENLKLNQSKV
LEQLHRQDEVNKSLKEKTLQQKQSCEDLQRDVDTKNELLKQKTMELTRACQKQYELEQEL
AFYKIDAKFEPLNYFPSEDVELDNVPGESPYIGKARYKRNMFIREGYVTSKAQQMGTGKM
QSDENDLCMKSQLEPQFQTLDEQLENKEKKIHSVLKK
Download sequence
Identical sequences G1MX05
ENSMGAP00000003334 ENSMGAP00000003334

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]