SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000003512 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000003512
Domain Number 1 Region: 233-433
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.88e-47
Family DBL homology domain (DH-domain) 0.0000000981
Further Details:      
 
Domain Number 2 Region: 425-549
Classification Level Classification E-value
Superfamily PH domain-like 2.49e-36
Family Pleckstrin-homology domain (PH domain) 0.000008
Further Details:      
 
Domain Number 3 Region: 1-122
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.57e-25
Family Calponin-homology domain, CH-domain 0.001
Further Details:      
 
Domain Number 4 Region: 163-231
Classification Level Classification E-value
Superfamily SH3-domain 5.51e-24
Family SH3-domain 0.0000298
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000003512   Gene: ENSMGAG00000003749   Transcript: ENSMGAT00000004216
Sequence length 773
Comment pep:known_by_projection chromosome:UMD2:9:3941154:3969516:-1 gene:ENSMGAG00000003749 transcript:ENSMGAT00000004216 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNPEEQVVTWLISLGVLNSPKKIIDDPEEFLKTSLKDGTVLCKLIHRLLPGSAEKYCLEP
KNEADCIGNIQEFLRGCAALKVELFEPHDLYSGEQFSKVLSTLTAVNKATEDQPSEGPCS
HPSALSSAAGGAHTDSNSTASQSAKVLRRQSKAVEMTENGSHQLVVKARFNFKQTNEDEL
SVNKGDIIYVTRVEEGGWWEGTLNGKTGWFPSNYVREIKSTDKPLSPKALKGLESTQLTK
NYYPVVLQNILETERDYAKELQSLLGTYLRPLQSYDKLSAVDIASLLGNVEEISAFQQTL
NQALEDVAKLPENQQRVGGCFMNLMAQFRSLYLTYCANHPSAVNVLTQHSDELEKFMESQ
GAANPGILILTTSLSKPFLRLDKYVTLLQELERHVEEAHADHEDILKAITSFKSLVSQCQ
ELRKRKQLELQILSESIQRWEGEDIKTMGNIIYMSQVMVQSGSSEEKEERYFLLFSNVLL
MLSASPRMSGFIYQGRLPLTGMTLTKLEDAEGNEHVFEIAGNMMERITVSCSTSQDLHEW
LEHLQRLTKGTCNTVSKTQSWSAHSTFGSTGQIRGPLEPPKILKPWSLSCLRPAPPLRPS
AALSYKERMSYILKDSSKSPKTMKKFLPKRKTERKASDEEFVIRKSTAALEEDAQILKVI
EAYCTGAGFQQALSSGSRKDSIPQVLLPEEEKIIIEETRSNGQTVTEEKSLVDTVYALKD
EVKELKQENKRMKQCLEEELKSRKDLEKLVRRLLKQTDECSREETGRKSSLIA
Download sequence
Identical sequences G1MXE9
ENSMGAP00000003512 ENSMGAP00000003512 XP_010713514.1.16129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]