SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000003570 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000003570
Domain Number 1 Region: 20-181
Classification Level Classification E-value
Superfamily L domain-like 1.33e-45
Family L domain 0.0000157
Further Details:      
 
Domain Number 2 Region: 298-490
Classification Level Classification E-value
Superfamily L domain-like 5.95e-45
Family L domain 0.0000024
Further Details:      
 
Domain Number 3 Region: 475-606
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.65e-22
Family Growth factor receptor domain 0.00000333
Further Details:      
 
Domain Number 4 Region: 158-308
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.57e-16
Family Growth factor receptor domain 0.000000718
Further Details:      
 
Domain Number 5 Region: 734-801
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.000000000000995
Family Protein kinases, catalytic subunit 0.0000882
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000003570   Gene: ENSMGAG00000003739   Transcript: ENSMGAT00000004274
Sequence length 801
Comment pep:novel chromosome:UMD2:7:4179345:4425662:1 gene:ENSMGAG00000003739 transcript:ENSMGAT00000004274 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AVCAGTENKLSSLSDLEQQYRALRKYYENCEVVMGNLEITSIEHNRDLSFLRSIREVTGY
VLVALNQFEYLPLENLRIVRGTKLYEDRYALAIFLNYRKDGNFGLRELGLKNLTEILNGG
VYVGQNKFLCFADTIHWQDIVRNPWASNFTLVPTNGSSGCGRCHKSCTGRCWGPTENHCQ
TLTKTVCAEQCDGRCYGPYVSDCCRECAGGCSGPKDTDCFACMNFNDSGACVTQCPQTFV
YNPTTFQLEHNHNAKYTYGAFCVKKCPHNFVVDSSSCVRACPSSKMEVEENGIKMCKPCT
DICPKACDGIGTGSLVSAQTVDSSNIDKFINCTKINGNLIFLVTGIHGDPYHTIAAINPE
KLNIFQTVREITGYLNIQSWPENMTDFRVFSNLVTIGGRALYSGLSLLILKQQGITSLQF
QSLKQISAGNIYITDNSNLCYYHTVNWTSLFSTPSQKTVIHRNKKAENCTADGMVCNELC
SSDGCWGPGPDQCLSCKRFIRGRTCIESCNLYDGEFREFANGSVCVECDPQCEKMEDNMI
TCYGPGPDHCTKCFHFKDGPNCVEKCPDGLQGANSFIFKYADEDRECHPCHPNCTQGCRG
PASHDCIYYPWTRQSTLPQHARTPLIAAGVIGGLFIIVIMGLTFAVYVRRKSIKKKRALR
RFLETEVRPLLCASAVAATALGNAAHLKTCHLQRKFVIGDLCVVTVSKGSTVPETFHCGH
AIALLSQAEALTGSLLLFQEALIMASMDHPHLVRLLGVCLSPTIQLVTQLMPHGCLLDYV
HEHKDNIGSQLLLNWCVQIAK
Download sequence
Identical sequences G1MXJ5
ENSMGAP00000003570 ENSMGAP00000003570

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]