SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000003603 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000003603
Domain Number 1 Region: 546-758
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.31e-50
Family DBL homology domain (DH-domain) 0.00028
Further Details:      
 
Domain Number 2 Region: 236-380
Classification Level Classification E-value
Superfamily PH domain-like 4.92e-43
Family Third domain of FERM 0.00047
Further Details:      
 
Domain Number 3 Region: 894-1037
Classification Level Classification E-value
Superfamily PH domain-like 1.31e-33
Family Pleckstrin-homology domain (PH domain) 0.002
Further Details:      
 
Domain Number 4 Region: 743-867
Classification Level Classification E-value
Superfamily PH domain-like 4.88e-31
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 
Domain Number 5 Region: 133-235
Classification Level Classification E-value
Superfamily Second domain of FERM 5.36e-25
Family Second domain of FERM 0.00016
Further Details:      
 
Domain Number 6 Region: 53-133
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.61e-20
Family First domain of FERM 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000003603   Gene: ENSMGAG00000003781   Transcript: ENSMGAT00000004307
Sequence length 1054
Comment pep:known_by_projection chromosome:UMD2:11:4522711:4577296:1 gene:ENSMGAG00000003781 transcript:ENSMGAT00000004307 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGEIEGTYRVLQTPGSRLGVQKNAGVSTLEPGQNLSTAMALSPARTHERDLQIKIKMLDN
TVEVLDIESKYYGQALLTEVYKHLNLIESDYFGIEFQNIQSYWIWLEPMKPVIKQVRRPK
TTMLRLAVKFFPPDPGQLQEEYTRYLFALQIKRDLAEERLTCSDNTAALLISHLLQLIAE
IGDFDESEDREHLKGNRYLPNQERIQGKILEFHRKHVGQTPAESDFQVLEIARKLEMYGI
RFHLASDREGTKINLAVSHMGVLVFQGNTKINTFNWSKVRKLSFKRKRFLIKLHPEVCGP
YQDTLEFLLGSRDECKNFWKICVEYHTFFRLFDQPKPKAKAVFFSRGSSFRYSGRTQKQL
VDYIKDSGMKKTPYERRHSKVVHSVKLTASSPDRYSTEAVDMNMEDEFEFEEGRKKGGGK
SGCLSGFLPTMTLLDPTMNPSQMLDRAPVSDSKCLRGFPGWLLPEGNVKPRATQQARPPR
SGPLIISAELSSLVLKSPLGLNAAFPVNLNAAGQGSSPLLSPVLSDAGGARIEEDDEMKR
KRYPTDKAYFIAKEILATERTYLKDLEVITVWFRSAVIKENAMPEGLMTLLFSNIDPIYE
FHRGFLKEIEQRLSLWEGKTNAHVKGDYQRIGDVMLRNMRTLKEFTSYLQKHDEVLTELE
KATKRLKKLEMVYKEFELQKVCYLPLNTFLLKPIQRLMHYKLILGRLCKHYTAEHRDFAD
CRNALKEVTEMTSQLQHSLIRLENFQKLTELQHDLIGIDNLTAPGREFIREGCLYKLTKK
GLQQRMFFLFSDMLLYTSKGVTGTNQFKIHGHLPLHGMLVEESENEWAVPHCFTIYSAQK
TIVVAASTRLEMGKWMEDLNMAIEMAKKSTEKSDMLLDNSVCNRSNRSSDEVSLEQESED
DIHSSRSSLDRQSHHRANTTMHVCWYRNTSVSMADHSVAVENQLSGYLLRKFKNSNGWQK
LWVVFTNFCLFFYKTHQDDYPLASLPLLGYVVSSPVEADGIQKDYVFKLQFKSHVYFFRA
ESKYTFERWMEVIKRATSSPARSSLLLPKDEKDR
Download sequence
Identical sequences G1MXL9
ENSMGAP00000003603 ENSMGAP00000003603

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]