SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000003820 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000003820
Domain Number 1 Region: 26-180
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.54e-35
Family Tandem AAA-ATPase domain 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000003820   Gene: ENSMGAG00000004063   Transcript: ENSMGAT00000004529
Sequence length 204
Comment pep:known_by_projection chromosome:UMD2:13:3206820:3207493:1 gene:ENSMGAG00000004063 transcript:ENSMGAT00000004529 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLSQMLARFVDVDSFVNLSTQSLHRLPSHVQQKFVRLKGQDKLPELVQLLKERSASSGAV
LIFCNSASTVNWLGYILDDHKIKHLRLQGQMLAAARAGIFASFQKGDVSVLICTDLASRG
LDTSSVQLVVNYDFPNTLQDYLHRVGRVGRVGSKMPGAVVSFVTHRWDVDLVQKIETAAR
KRTSLPGMDASINEPPPKTQQVSV
Download sequence
Identical sequences G1MY30
ENSMGAP00000003820

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]