SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000004209 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000004209
Domain Number 1 Region: 309-654
Classification Level Classification E-value
Superfamily L domain-like 2.58e-54
Family Ngr ectodomain-like 0.0014
Further Details:      
 
Domain Number 2 Region: 100-159
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000722
Family VWC domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000004209   Gene: ENSMGAG00000004416   Transcript: ENSMGAT00000004922
Sequence length 701
Comment pep:known_by_projection chromosome:UMD2:14:3337535:3354039:1 gene:ENSMGAG00000004416 transcript:ENSMGAT00000004922 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQVSSFIYYFLLVSLCIDLSQNETSAALRRQRRRMRHRGLRRSSYAGRRLLRQPRMKLAA
PAAPSIPLINIDDGVVGVFDSLIGLGGHESSYSVLPGKKGQCTANGMIMFDKAVWSPKPC
ITCLCSKGEVICDTTMCHPLKCPQTIIPAGECCPVCSDTASSLDSNIVSLDDIIELSGDS
PEPNNLDNNPNVLSSARTQTEMDELLRTEVVEIKEKEVHKKGEKRRKKKGKKNQQKHKAH
QKEEKPDGKEDEERRRLFEEEELQLEKEVIKKRQGIRTREGDAEESDEDDETFPIPVPPI
EAPPLPAACSTSESTVSCINAKLTQIPPISDPDLTSLDLTGNIITTISNEAFNGIPNLEW
IDLSKNNISSSGISPHAFKTLKKLKRLYLDGNMLVHIPSELPSALEEIKINDNQLHAIDE
DALQGLKNLVTLELEGNKLSEANVSPLAFYPLTSLSYLRLGRNKFRIIPQGLPTTLEELY
LENNQIEEVSEICFNHTRKINVIVLKHNKLEEHRIAPLAWINQENLESIDLSYNKLYHVP
SYLPKSLLHLILIGNQIERIPGYVFGHMKPGLEYLYLSFNKLTDDGIDPVSFFGAYHSLR
ELFLDHNDLKSVPFGIEEMRKLRFLRLNNNKIRTVPPERICRTHLHDDDVHYNSEEDETE
DSRLEHVHLENNYINTRQLSPHSFSCIRSYCSVVLKPQKTK
Download sequence
Identical sequences G1MYY9
ENSMGAP00000004209 XP_010716691.1.16129 XP_010716692.1.16129 XP_010716693.1.16129 XP_010716694.1.16129 ENSMGAP00000004209

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]