SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000004493 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000004493
Domain Number 1 Region: 26-275
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 9.75e-91
Family Calponin-homology domain, CH-domain 0.00000455
Further Details:      
 
Domain Number 2 Region: 293-413
Classification Level Classification E-value
Superfamily Spectrin repeat 1.7e-31
Family Spectrin repeat 0.0001
Further Details:      
 
Domain Number 3 Region: 1630-1783
Classification Level Classification E-value
Superfamily Spectrin repeat 4.01e-27
Family Spectrin repeat 0.0019
Further Details:      
 
Domain Number 4 Region: 1215-1368
Classification Level Classification E-value
Superfamily Spectrin repeat 7.72e-26
Family Spectrin repeat 0.00051
Further Details:      
 
Domain Number 5 Region: 2167-2287
Classification Level Classification E-value
Superfamily PH domain-like 4.38e-25
Family Pleckstrin-homology domain (PH domain) 0.0000714
Further Details:      
 
Domain Number 6 Region: 895-1049
Classification Level Classification E-value
Superfamily Spectrin repeat 6.55e-25
Family Spectrin repeat 0.0029
Further Details:      
 
Domain Number 7 Region: 1843-1996
Classification Level Classification E-value
Superfamily Spectrin repeat 1.31e-23
Family Spectrin repeat 0.0015
Further Details:      
 
Domain Number 8 Region: 1112-1249
Classification Level Classification E-value
Superfamily Spectrin repeat 4.05e-19
Family Spectrin repeat 0.0000506
Further Details:      
 
Domain Number 9 Region: 620-735
Classification Level Classification E-value
Superfamily Spectrin repeat 2.04e-18
Family Spectrin repeat 0.00051
Further Details:      
 
Domain Number 10 Region: 422-520
Classification Level Classification E-value
Superfamily Spectrin repeat 8.64e-18
Family Spectrin repeat 0.00042
Further Details:      
 
Domain Number 11 Region: 1467-1580
Classification Level Classification E-value
Superfamily Spectrin repeat 2.36e-16
Family Spectrin repeat 0.00041
Further Details:      
 
Domain Number 12 Region: 513-633
Classification Level Classification E-value
Superfamily Spectrin repeat 8.11e-16
Family Spectrin repeat 0.0012
Further Details:      
 
Domain Number 13 Region: 1339-1434
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000942
Family Spectrin repeat 0.0032
Further Details:      
 
Domain Number 14 Region: 731-845
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000144
Family Spectrin repeat 0.0027
Further Details:      
 
Domain Number 15 Region: 2001-2061
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000864
Family Spectrin repeat 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000004493   Gene: ENSMGAG00000004480   Transcript: ENSMGAT00000005209
Sequence length 2323
Comment pep:known_by_projection chromosome:UMD2:5:6254516:6271367:-1 gene:ENSMGAG00000004480 transcript:ENSMGAT00000005209 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TMTSENDYDHLELQQSYSHWDASDDELDNDNSSARLFERSRIKALADEREAVQKKTFTKW
VNLHLACVTCRISDLYLDLRDGRMLIKLLEVLSKEMLPKPTKGRMRIHCLENVDKALQFL
KEKQVHLENMGSHDIVDGNHRLILGLIWTIILRFQVQDVIKEMKEGPETRSPRDALLLWC
QMKTAGYPHVNVTNFTSSWKDGLAFNALIHKHRPELFDFKTLTKSNARHNLEHAFSVAER
HLGITPLLDPEDVFTENPDEKSIITYVVAFYHYFSEMKKLEVKGRRLGKVIEHAKETKRM
IDGYGGLASNLLTWIEQTIVSLNSRSFANSLAGVQHQLQAFSTYRTVEKPPKFQEKGNLE
VLLFTIQSRMRANNQRVYTPQEGRLVCDINRAWEKLEKAEHERELALRNELIRQEKLEQL
ARRFDRKAAMREAWLSENQRLVAQQDNFGQDLTAVEAAKKKHEAIETDTAAYKERVQAXE
LEREGYHDIKRIRGRKDNILRLWEQLQELLRNRRQRLEMNLTLQHLFQEMLHSINWMDEV
KVQLASSESGKHLLEVEELLETHRLLEGDMALQAEKVRAISAAALRFTDAEGYRPCDPRV
IRDRVNHLEMCRQELQALAARRKALLEQSRAVWQCLQELDEAESWIKEQEHIYSALDYGK
DLVGVLLLRRRHTALEAELEAQGARLEKALVMAEQLAAAGRDAGRLRDRAAAVRVLWDQL
QELVTFRRRGLREAEGFFQFQAEAEELAEVLAEARQRAASEELGHDEVHTQALLRDHQEL
LEELMAAQQLLERLGHQAEGFPPELRAGPEAHNRLAALQELHHEVSMLAKTRGRRLQDAL
NLYTVFGESEACQLWMGAKERWLEKLEVPNTLEELDVVKHRLDGLEQKMAGVASQIDAVN
RSADGLLESGHPHSPQVRQCQQQLNERWDHFRELVSQRRAAVGSALNLLSFQLECEETRA
WLLSKTRVVESTRELGHDLAGVLATQRKLYGIERELTAAESRLDALRPQADLLAQERPEL
AEDTAGRLAGAQDAMDGLQGALRDRAAALGEVGQLQSFLQDLDDFQAWLFRAQKAVAATE
EVPTSLGEAEEMLRKHAAAHEDAEGHAAAFTALLEAGKRVTSNQEDPEYEQLRERLRGVE
AGWGALHKMWDARQCFLAQCLGFQEFLRDAKQAEILLANQEYTLAHLELPPTLEGSTAAL
RRFEDFRASMESSAEKVPSVVTTGSKLVAEGNIFSEKISEKNQALQERHQVNVAKAQEAV
GLLQDNHKLQSFLQSCRELAAWVDEKMLTVQDASYGDARGLHGKWQKHQAFMAELAANEA
WLEKIKAEGMELASCKPQYGAVVGRRLDELQALWNGLHGAAREKGQQLFEANRTELYAQS
YSDLERWLGQVEGELRTTERAKDLTGANLLLKKLTRLEEQVEARQEELVELKASLAGIAP
EPDGQEEKLQQRFLDLLKPLGKKRKELETSKAMYQLGRDLEDEMLWVQERMLWARSTEHG
TNLQSVQRLAKRNETLQKELQGHAPRLAEVLERGEAAAEGPCPELAERALELRAQWEALR
KEVAARQQRLREASEAQQYYLDAGEAEMWVSEQELFMGDEEKPKDEESGLVMLKRHVRQQ
RSIEDYGQTIKELAGRAQQLLSAGHPEGEQIIRLQGQVDKYYAGLKEAAEERRRRLENMC
HLFQLKREVEDLEQWIAERDVAASSQELGQDLDHVTMLRDKFREFARETGSIGQERVDQV
SLTIEDLIDAGHAEAATMAEWKDGLNESWADLLELIDTRMQLLATSYDLHKYFYDGSELL
ALIAARHQELPQDLGDDSGSVEAFHRMHSAFERDLQLLEGQVQQFREVAARLQTAYAGEK
AVSIQQQEQEVARALQALLEACSGRRAQLVDTADKFRFFSMARDLLSWMENTVRQIQTQE
KPRDVSSVELLMKYHQGIRAEIDARDKSFAACIELGKKLQQRKPQESSEIEAKLMELLDK
RKAMMEMWQQRWDRLQLLLEVCQFSRDASVAESWLMAQEPYLASSDYGQTVDAVEKLLKR
HEAFEKSTATWEERIAALRKLTTLELMGGRTLQEKDVVHDTAPEHHLDLDAELQIGSEEE
EEKRKGEISQEISPPAVDGPQPAWGHHLSACLPGDSHLGTASCILSPLLIVPKEEPIAPR
EEVATLPAQPTHVQLEGYLGRKHDLEAATKRASNRSWSTRYCVLRGEELAFFKDAKSRAL
GVPCQGEEPLGLRNACCQVAAGYKKKKHVFALLCSAPRLSNGSEWLFHGKDEEEMQTWLQ
GLHMAITSCQNLPAKARSLPPPHAPPEPRRDKEKRFSFFPKKK
Download sequence
Identical sequences G1MZL4
ENSMGAP00000004493 ENSMGAP00000004493

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]