SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000004514 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000004514
Domain Number 1 Region: 15-149
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.71e-28
Family Calponin-homology domain, CH-domain 0.0012
Further Details:      
 
Domain Number 2 Region: 631-709
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.55e-21
Family DIX domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000004514   Gene: ENSMGAG00000004662   Transcript: ENSMGAT00000005232
Sequence length 714
Comment pep:known_by_projection chromosome:UMD2:26:6604103:6631203:-1 gene:ENSMGAG00000004662 transcript:ENSMGAT00000005232 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLACLARGNLLDILQEGFTEQQLQAYVAWVNSQLKKKPTIKPVQDLRQDLRDGVILASLI
EIVGQQTAATQPNCRPSELLKFFASLAGEKLNGVQVNPTSHQEMRENVEQVLQFVASKKI
RMHQTSAKDIVDGNLKSIMRLILALAAHFKPGSGRAVNHSPAGMMGKSSAASFGSHRPRS
AAAVAQGAVAALADVRQDVLQSGRDVFWHRQRNSSMDEEIETPYWSVRALVQQYEGQHNI
PLESQSSSLTSPSPVHSTKSESTVTQSEEKAGFVIIHTEEAETKTEETESHFQPEWQAGN
PGSCLENSWEEQLLEQQDHLEKEMEEAKKMISGLQALLLNGSLPEDEQEGSFELCEHGAC
PEEQLIIIRSRLDQSEEENQDLKKELLKYKQEARNLQGIKDALQQRLAQQDASVLQLKQE
LLRANMDREELHNQNVDLQRKVEERNRLLAEYKKELGQKDRHLQQHQTKLDEMLRQLSEA
SYQQVDLERELEHKEALLAHCMKREAEEVMAYSSYNAQSNGFLQTAGKGAAPTAHRGVST
NDLQLVRDALRSLRNSFSGHDPQHHTIDSLEQGISSLMERLHRMETQKRQERRIRGKSPA
SRVTNECRDSWPPNSKLPHSHSTPAMSTSACTKVLYFTDRSLTPFMVSIPKRLGEVTLKD
FKVAIDREGTHRYHFKALDPEFGTVKEEVFHDDDIIPGWEGKIVAWVEEDHGEN
Download sequence
Identical sequences G1MZN0
ENSMGAP00000004514 ENSMGAP00000004514

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]