SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000004974 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000004974
Domain Number 1 Region: 103-277
Classification Level Classification E-value
Superfamily L domain-like 1.19e-34
Family Internalin LRR domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000004974   Gene: ENSMGAG00000005083   Transcript: ENSMGAT00000005699
Sequence length 677
Comment pep:known_by_projection chromosome:UMD2:12:5851554:5887677:1 gene:ENSMGAG00000005083 transcript:ENSMGAT00000005699 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FSSRAQAGSCGLQLLIQTSAIPSKTKPVIAVFFLHKEPPSLHNRLLQHDLEKNYSGRQGD
DSTNFGSSSSITFPVLQRSAEEKILNSDRLTLERQKLTVCPVIDGEDHLRLLNFQHNFIT
RIQNISNLQHLVFLDLYDNQIEEISGLSTLRSLRVLLLGKNRIKKISNLENLKNLDVLDL
HGNQISKIENINHLSELRVLNLARNLLSTVENLNGLDSLTELNLRHNQVSAIKDVDTLPR
LQRLFLSFNNISSFEDILCLADSSSLSDITLDGNPIAQETWYKHTVLHHMMQLRQLDMKR
ITEEERRMASVAARKEEERKRESHKQSLLKEKKRLTICNIARQWEIQQNRIDLVASLNQD
KDNQPCPINGSAAYVFPEESRSLDTILNSAVQGLSVLESHLVELEGDTLYLYGSGALECL
DRNWSVQTAGTVVTVSFVFIEYDEIVQVLTKLKIKFPNSVHLKFKETNLVTLQQFNALAQ
LHRMEQLTVDPQGNPVVNFTLWKYYVLFRLNHFNLQKINGIEVTQDDVVMAERLFGILAY
VASSELPRYRLLSSFGESRMKQFSYLLEGKGKKSGTGNEESSDNRRAGRESSARATLNYI
TKDFHMEKLEEIKERKTFCQTYVKNLVKEAADIHMKNESLQKLWPQMFIELVRDAVIEIR
NKNSYMKLSLQRITDQK
Download sequence
Identical sequences G1N0L5
ENSMGAP00000004974 ENSMGAP00000004974

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]