SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000005031 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000005031
Domain Number 1 Region: 87-213
Classification Level Classification E-value
Superfamily PH domain-like 8.13e-36
Family Pleckstrin-homology domain (PH domain) 0.00096
Further Details:      
 
Domain Number 2 Region: 2-89
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.44e-17
Family DBL homology domain (DH-domain) 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000005031   Gene: ENSMGAG00000005142   Transcript: ENSMGAT00000005757
Sequence length 691
Comment pep:novel chromosome:UMD2:30:3410641:3418800:-1 gene:ENSMGAG00000005142 transcript:ENSMGAT00000005757 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NFVKKIGNCSIVRRLGVQECILLVTQRITKYPVLVERIIQNTEVGTKDYEDLIHALNLIK
YTITHVDAVVNECEKGQRLKEIMHKMELKSSGKCKNGLFFRKDDMGQRRLLLDGMLYWKA
ASGRLKDVLAVLLNDVLLLLQEKDQKYMFVSVDSKPPVISLQKLIVREVANEEKAMFLIS
ASLEGPEMYEIHTSSKEERNSWMAHIRRAVESCPDEEGGSFCEPESERRLAEARAAKLRE
FQERLNTKDDLIVQSLSEKQQIYQEMSELYGFEDHSPGSQSRVLLLGDIPESLQGEALLK
SAVVEAENLQNLIFTHLGNGSCQCEESYAVGLPRRAETFAGYDSPSISNKNNSLEKNTGS
DQRQWDCRGPAGSLDVQLPDPPFDAEEGSQTSNTTRQDDSSGVQPTVESQLVQRIQTLLQ
LLFSLQAVISQQDSYIELQRATMVDREKQYRLQSTRGNLLLEQEKQRNFEKQREELMHVQ
KLQSQLKLEQQRWERERSQQRRELEISEAHLQRREEETRQLKEKLIQDREELERQREAYQ
HDLERLREAQRAVEKERERLDQLRKLKKQNTVSGTFSPELGQNPMQSHSVSFNGEGGEPS
PPVLKASARVSVSGMDYLERSELGRRDSTALESRPVLALKNEVPIHLLSATNQIQKPAAV
QQQIPTKLATFTKGSKEKSGKNKASHRTDSS
Download sequence
Identical sequences G1N0Q9
ENSMGAP00000005031 ENSMGAP00000005031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]